Gene Information

Name : Mesil_2637 (Mesil_2637)
Accession : YP_003685994.1
Strain : Meiothermus silvanus DSM 9946
Genome accession: NC_014212
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2680212 - 2680895 bp
Length : 684 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829:IPR011006:IPR001789:IPR001867; KEGG: ttj:TTHA1502 response regulator; PFAM: response regulator receiver; transcriptional

DNA sequence :
ATGGAGTCTATGGAACAACCCCTGATCCTGATTGTAGAAGATGAAAAAGACATCGCTCGGTTTATAGAACTCGAGCTGCA
AGCCGAGGGCTACCGAACCGAGGTAGCCTACGACGGCATCACCGGGCTTTCCCGATTTCGCGAGACCAATCCCAACCTGG
TGGTCTTGGATTTAATGTTGCCGGTAATGGACGGCATCGAAGTAGCGCGGCGTATCCGCAAAACCTCTAACGTGCCCATC
CTGATCCTTACCGCTAAAGACCGCGTGGAAGACAAAGTGGAAGGCCTCGACGCCGGGGCCGACGACTACCTGGTCAAACC
CTTCTCCATTGAGGAGCTGCTGGCCCGCATCCGCGCCCACCTGCGCCGGGTGACCCCGGCTATCACCGGGGAGATCCGCG
TTGCAGACCTCATCATCAACCTCGAGGGCCGCGAGGTCTACCGCTCGGGCCGCCGCATCGAGCTTTCCAACAAGGAGTTC
GAGCTGCTGGAACTCCTCGCCAAGAGCCCAGGCAAAGTCTTCAGTCGCTTCGAGATCGAGGAGAAAGTCTGGCCCGGTTA
CCAAGGCGGCAGCAACGTGGTGGATGTGTACATCGGTTACTTGCGCAAGAAGCTCGAGGGCATCGGCGAGCGCCGCTTGA
TCCATACCGTGCGCGGTGTGGGGTACGTTCTCAGAGAGGATTGA

Protein sequence :
MESMEQPLILIVEDEKDIARFIELELQAEGYRTEVAYDGITGLSRFRETNPNLVVLDLMLPVMDGIEVARRIRKTSNVPI
LILTAKDRVEDKVEGLDAGADDYLVKPFSIEELLARIRAHLRRVTPAITGEIRVADLIINLEGREVYRSGRRIELSNKEF
ELLELLAKSPGKVFSRFEIEEKVWPGYQGGSNVVDVYIGYLRKKLEGIGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-30 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 51
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-33 50
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-33 49
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-37 48
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-28 45
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-29 44
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-34 44
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-25 44
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-31 44
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-27 44
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-33 43
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 2e-21 43
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-27 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-28 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-33 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-29 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-27 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 3e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-43 50
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-34 44
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-31 43
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-26 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-34 42
Mesil_2637 YP_003685994.1 winged helix family two component transcriptional regulator VFG1702 Protein 9e-26 41