Gene Information

Name : Snov_0725 (Snov_0725)
Accession : YP_003692675.1
Strain : Starkeya novella DSM 506
Genome accession: NC_014217
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 749753 - 750454 bp
Length : 702 bp
Strand : +
Note : KEGG: rpb:RPB_3454 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
GTGCGCCTGCTCGTTGTCGAGGACGATCCCGATCTCAACCGCCAGATGGTCGAGGCGCTGACCGACGCCGGCTACGCCGT
CGACCGCGCCTATGACGGCGAGGAGGGCCATTTCCTCGGCGAGACCGAGCCCTATGACGCCATCGTGCTCGATATCGGCC
TGCCGAAGATGGACGGGCTCTCGGTGCTGGAAGCCTGGCGGCGCGAGGGGCGCAAGATGCCGGTGCTCATCCTCACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGACGATTATGTGGCGAAGCCCTTCCACATGGAGGA
GGTGCTGGCGCGCATCCGCGCGCTGCTGCGCCGCTCCGCCGGCCATGCCGCGAGCGAACTGACCTGCGGGCCGGTGATGC
TGGACACGCGCTCCGGCCGGGTGACGGTGGACGGCCGGCAGGTGAAGCTCACATCGCACGAGCACCGCCTGCTCGCCTAT
CTCATGCACCATTCCGGCCGCGTGGTCTCGCGCACCGAGCTGGTCGAGCATCTCTACGATCAGGACTTCGACCGCGATTC
CAACACGATCGAAGTCTTTGTCGGAAGATTGCGCAAGAAGCTCGACGTCGAGGTGATCCAGACCGTGCGCGGCCTCGGCT
ATCTGCTGGTGCCGCCCGAGGCGCCGCGTCAGGAGACGCAGTCCAAGGGAACGCCCGGCTGA

Protein sequence :
MRLLVVEDDPDLNRQMVEALTDAGYAVDRAYDGEEGHFLGETEPYDAIVLDIGLPKMDGLSVLEAWRREGRKMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHMEEVLARIRALLRRSAGHAASELTCGPVMLDTRSGRVTVDGRQVKLTSHEHRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRLRKKLDVEVIQTVRGLGYLLVPPEAPRQETQSKGTPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-27 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snov_0725 YP_003692675.1 two component transcriptional regulator NC_002516.2.879194.p Protein 8e-39 47
Snov_0725 YP_003692675.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-34 46
Snov_0725 YP_003692675.1 two component transcriptional regulator BAC0530 Protein 1e-34 46
Snov_0725 YP_003692675.1 two component transcriptional regulator CP004022.1.gene1005. Protein 2e-36 45
Snov_0725 YP_003692675.1 two component transcriptional regulator CP001918.1.gene2526. Protein 1e-33 44
Snov_0725 YP_003692675.1 two component transcriptional regulator NC_002695.1.913289.p Protein 4e-34 44
Snov_0725 YP_003692675.1 two component transcriptional regulator CP000034.1.gene2022. Protein 1e-34 44
Snov_0725 YP_003692675.1 two component transcriptional regulator CP001138.1.gene1939. Protein 2e-34 44
Snov_0725 YP_003692675.1 two component transcriptional regulator BAC0487 Protein 1e-29 43
Snov_0725 YP_003692675.1 two component transcriptional regulator BAC0197 Protein 3e-28 42
Snov_0725 YP_003692675.1 two component transcriptional regulator BAC0111 Protein 6e-30 41
Snov_0725 YP_003692675.1 two component transcriptional regulator BAC0125 Protein 8e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snov_0725 YP_003692675.1 two component transcriptional regulator VFG0475 Protein 1e-34 44
Snov_0725 YP_003692675.1 two component transcriptional regulator VFG0473 Protein 7e-28 43
Snov_0725 YP_003692675.1 two component transcriptional regulator VFG1389 Protein 4e-25 43
Snov_0725 YP_003692675.1 two component transcriptional regulator VFG1390 Protein 4e-27 42
Snov_0725 YP_003692675.1 two component transcriptional regulator VFG0596 Protein 2e-25 41