Gene Information

Name : Trad_1590 (Trad_1590)
Accession : YP_003705252.1
Strain : Truepera radiovictrix DSM 17093
Genome accession: NC_014221
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1709022 - 1709699 bp
Length : 678 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR005829:IPR001789:IPR001867:IPR011006; KEGG: ddr:Deide_01470 putative response regulator, CheY; PFAM: response regulator receiver

DNA sequence :
ATGGACCGCAAACCCCTTGTCCTCATCATCGAGGACGAAAAAGAGATCGCCAAGTTTATCGACCTCGAGCTGCAAGCCGA
GTCGTACGAGACGGTCGTGACCTACGACGGGGTCACGGGGCTCTCCAAGTTTCGCGAACTCAACCCCGACCTCGTCGTGC
TCGACCTCATGCTCCCCGTTCTAGACGGGCTCGAGGTCGCGCGGCGGGTGCGCAAAACCTCGAACACGCCGATTATCATC
CTGACCGCTAAAGACAGCGTCGACGACAAGGTCTTGGGCCTCGACTCGGGCGCCGACGACTACCTCGTCAAACCGTTCTC
CATCGAGGAGCTTTTGGCGCGGGTGCGCGCGCACTTAAGGCGCGTCAACCCCGCGGTCACGGGTGAGGTGCGCGTCGCCG
ACCTCGTGATGAACCTAGATGGGCGCGAGGTCTTTCGCGACGGGCGCCGCATCGAGCTCTCGGCCAAGGAGTTTGAGCTC
CTGGAGCTTTTTGCCCGCAGCCCTGGAAAGGTCTTTAACCGCTTCGAGATCGAGGAGAAGGTCTGGCCCGAATACACCGG
GGGGAGTAACGTCGTCGATGTCTACGTCGGGTACCTGCGGCGCAAGCTCGAGCACGACGGCGAGCGCCGTTTAATCCACA
CCGTCCGCGGCGTCGGGTACGTTTTGCGCGAGGAGTAG

Protein sequence :
MDRKPLVLIIEDEKEIAKFIDLELQAESYETVVTYDGVTGLSKFRELNPDLVVLDLMLPVLDGLEVARRVRKTSNTPIII
LTAKDSVDDKVLGLDSGADDYLVKPFSIEELLARVRAHLRRVNPAVTGEVRVADLVMNLDGREVFRDGRRIELSAKEFEL
LELFARSPGKVFNRFEIEEKVWPEYTGGSNVVDVYVGYLRRKLEHDGERRLIHTVRGVGYVLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-23 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 8e-32 51
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-26 47
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-28 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-22 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator BAC0125 Protein 8e-29 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-25 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-25 44
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-22 43
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-22 43
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator BAC0111 Protein 6e-26 43
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-26 43
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-22 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-24 42
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-21 41
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-35 50
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-23 43
Trad_1590 YP_003705252.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-29 43