Gene Information

Name : phoB (XNC1_0748)
Accession : YP_003711043.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with PhoR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 647377 - 648066 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGGTTAAACGTATTTTGGTAGTTGAAGATGAAGTACCGATCCGTGAAATGGTTTGTTTTGTACTCGAGCAAAACGGTTA
TCAGGCCATTGAGGCTGAAGATTATGATACGGCAATAAGACGGTTGTCGGAGCCTTATCCCGATTTGGTGTTGTTAGACT
GGATGCTTCCCGGTGGTTCAGGGATACAGCTTATTAAACACATGAAGCGGGACCATAACACCAAAACGATCCCGGTTATT
ATGGTAACAGCACGTGCGGAAGAAGAAGACCGGGTGCGTGGGCTTGATGTCGGGGCAGATGACTATATCACTAAGCCTTT
TTCACCGAAGGAATTGATTGCTCGTGTTAAAGCTGTTCTTCGCAGAATTTCGCCTATGGAAGCAGAAGAGGTGATTAATA
TGGATGGGCTAATATTAGATCCATCATCTCATCGTGTTTCCAGTCAGGGGCTGGATTTGAATATGGGGCCGACTGAGTTC
AAACTTCTCCACTTTTTTATGACCCATCCAGAGCGGGTTTATAGCCGCGAGCAGTTACTCGATTATGTGTGGGGAACGAA
TGTGTATGTGGAAGATCGTACTGTTGATGTGCATATCCGGCGTTTACGTAAGGCATTAGAAGCCGGGAAGCACGATAAAA
TGGTACAAACGGTTCGTGGCACAGGGTACCGCTTTTCTACTCGTTATTAA

Protein sequence :
MVKRILVVEDEVPIREMVCFVLEQNGYQAIEAEDYDTAIRRLSEPYPDLVLLDWMLPGGSGIQLIKHMKRDHNTKTIPVI
MVTARAEEEDRVRGLDVGADDYITKPFSPKELIARVKAVLRRISPMEAEEVINMDGLILDPSSHRVSSQGLDLNMGPTEF
KLLHFFMTHPERVYSREQLLDYVWGTNVYVEDRTVDVHIRRLRKALEAGKHDKMVQTVRGTGYRFSTRY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR NC_010410.6002989.p0 Protein 7e-35 42
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR NC_010400.5986590.p0 Protein 6e-37 42
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR NC_011595.7057856.p0 Protein 7e-35 42
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR HE999704.1.gene2815. Protein 1e-37 42
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR BAC0596 Protein 2e-33 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR BAC0039 Protein 2e-33 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR CP001918.1.gene3444. Protein 7e-34 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR CP001138.1.gene2239. Protein 2e-33 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR CP000034.1.gene2186. Protein 2e-33 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR NC_002695.1.916589.p Protein 1e-33 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR CP000647.1.gene2531. Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR VFG1563 Protein 7e-35 41
phoB YP_003711043.1 response regulator in two-component regulatory system with PhoR VFG1702 Protein 1e-34 41