Gene Information

Name : XNC1_3134 (XNC1_3134)
Accession : YP_003713306.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3085175 - 3085492 bp
Length : 318 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : enzyme

DNA sequence :
ATGTGCAACGGGTTCAACGGTCTGGCCTCAAAGGTGCAAAACGCACTGAAAGATAATCCGTTCTCCGGGCAGGTCTTCAT
CTTCCGTGGTCGCCGGGGTGATATGCTTAAGGTACTGTGGGCTGATGCCGATGGGTTGTGTCTGTTTACCAAACGGCTTG
AGCGTGGGGGCTTCGTCTGGCCGGTGACCCGTGAGGGTAAAGTTCATCTGACTCCCGCCCAACTGTCCATGCTGCTGTCC
ATGCTGCTGTCCATGCTGCTTGAAGGCATAAACTGGAAACATCCGCAGCGGATGGAACGATCTGGTCTACGGATATAA

Protein sequence :
MCNGFNGLASKVQNALKDNPFSGQVFIFRGRRGDMLKVLWADADGLCLFTKRLERGGFVWPVTREGKVHLTPAQLSMLLS
MLLSMLLEGINWKHPQRMERSGLRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-31 80
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-31 80
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-31 79
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-29 75
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-29 75
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-23 64
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-23 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-23 64
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-24 64
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-23 64
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-24 64
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-23 64
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-23 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-23 64
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-23 64
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-23 64
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-23 64
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-23 62
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-24 60
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-24 60
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-22 58
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-22 58
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-22 57
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-17 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNC1_3134 YP_003713306.1 transposase VFG1665 Protein 1e-31 79
XNC1_3134 YP_003713306.1 transposase VFG1698 Protein 2e-24 64
XNC1_3134 YP_003713306.1 transposase VFG1709 Protein 8e-24 64
XNC1_3134 YP_003713306.1 transposase VFG0792 Protein 8e-24 64
XNC1_3134 YP_003713306.1 transposase VFG1052 Protein 2e-23 62
XNC1_3134 YP_003713306.1 transposase VFG1737 Protein 7e-23 57