Gene Information

Name : alpA (XNC1_3345)
Accession : YP_003713511.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Virulence
Product : prophage CP4-57 regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3268499 - 3268705 bp
Length : 207 bp
Strand : +
Note : Evidence 2b : Function of strongly homologous gene; PubMedId : 7511582; Product type h : extrachromosomal origin

DNA sequence :
ATGACAATGACAGCACCGAAAGAAAATCTTATTCGTTTGCCCGAAGTTCAGCGCAGAACGGGTTATAGCAAGGCGTGGAT
TTACAAACTGATTAGCGATGGGGAATTTCCGAAACAGATTAAACTCGGCTCCCGTTCCATCGCGTTTATTGAATCAGAAA
TTGATAACTGGATTGCGCAGCGTATCGCAGGATCACGGGTGGCATAA

Protein sequence :
MTMTAPKENLIRLPEVQRRTGYSKAWIYKLISDGEFPKQIKLGSRSIAFIESEIDNWIAQRIAGSRVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 6e-08 47
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-08 47
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 3e-05 45
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 3e-05 45
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 1e-06 44
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 1e-06 44
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 1e-06 44
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 2e-07 43
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 4e-07 43
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 1e-05 42
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 9e-08 42
unnamed CAA21398.1 - Not tested HPI Protein 1e-07 42
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 4e-11 42
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 5e-07 41
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 8e-07 41
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 8e-07 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
alpA YP_003713511.1 prophage CP4-57 regulatory protein VFG1480 Protein 2e-08 47
alpA YP_003713511.1 prophage CP4-57 regulatory protein VFG1118 Protein 4e-07 44
alpA YP_003713511.1 prophage CP4-57 regulatory protein VFG0651 Protein 2e-07 41