Gene Information

Name : XNC1_3442 (XNC1_3442)
Accession : YP_003713601.1
Strain : Xenorhabdus nematophila ATCC 19061
Genome accession: NC_014228
Putative virulence/resistance : Virulence
Product : phage-like protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3341815 - 3342027 bp
Length : 213 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 15263089

DNA sequence :
ATGTCAATAATTACCACACCTAAAGAAAGTCTTATTCGTTTATCAGAAGTTCAACTCAGAACAGGTTACAGTAAGGCGTG
GATTTATAGACTTATCGGAGAAGATAAATTCCCGAAGCAAATCAAAATCGGCACTCGCTCAGTTGCTTTTCTTGAATCAG
AAGTTGATGGCTGGATAGCTCAACGTATTTCTGAATCTCGCGGTGAAATGTAA

Protein sequence :
MSIITTPKESLIRLSEVQLRTGYSKAWIYRLIGEDKFPKQIKIGTRSVAFLESEVDGWIAQRISESRGEM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 3e-09 50
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 3e-09 50
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 4e-07 48
unnamed CAA21398.1 - Not tested HPI Protein 5e-07 48
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 1e-09 44
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 5e-08 43
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-08 43
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-04 41
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-04 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
XNC1_3442 YP_003713601.1 phage-like protein VFG1141 Protein 9e-10 50
XNC1_3442 YP_003713601.1 phage-like protein VFG1480 Protein 2e-08 43