Gene Information

Name : Aazo_0389 (Aazo_0389)
Accession : YP_003720073.1
Strain : Nostoc azollae 0708
Genome accession: NC_014248
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 393566 - 394240 bp
Length : 675 bp
Strand : -
Note : KEGG: ana:alr1194 two-component response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGACACACATCTTACTGGTTGAAGATGAAGTGAAATTGGCTCGATTTATAGAACTAGAATTGAGTTATGAAGGCTATCA
AGTTAGCGTAGCTTATGATGGACTGACTGCACTGACAGCAGCACGACAGTTAAATCTAGATTTAATAATCTTAGATTGGA
TGCTACCTGGTGTTTCGGGTTTAGAAATTTGTCGTCGCTTGCGAGCTAGCGGTGATAAAGTACCGATAATTTTATTAACT
GCTAAAGATGAAGTTAGCGCTTGCGTGGCTGGTTTAGATGCTGGTGCTGATGATTACGTAGTTAAACCATTCAGTTTGGA
AGAATTATTAGCCAGAGTCCGCGCTCATTTACGTAGAAGTAAAGAAACAGATAGCGCAGATATCTTAATGTTTGATGATT
TGAGTTTAAATCGGAGTACGGGGGAAGTCTACCGAGGACAGCGTTTAGTCGAGTTGACTGCAAAGGAATTTGATTTACTG
GACTATTTACTCACCCATCCGCGACAGGTAATTACACGCGATCGCATTTTAGAAGAAGTCTGGGGTTACGACTTCATGGG
TGATTCCAACGTTATAGAAGTTTACATTCGTTACTTACGCCTAAAACTCGAAGCCAACAACGAAAAGCGTCTCCTCCAAA
CCGTGCGTGGTGTCGGTTACGTATTGCGTGATTAA

Protein sequence :
MTHILLVEDEVKLARFIELELSYEGYQVSVAYDGLTALTAARQLNLDLIILDWMLPGVSGLEICRRLRASGDKVPIILLT
AKDEVSACVAGLDAGADDYVVKPFSLEELLARVRAHLRRSKETDSADILMFDDLSLNRSTGEVYRGQRLVELTAKEFDLL
DYLLTHPRQVITRDRILEEVWGYDFMGDSNVIEVYIRYLRLKLEANNEKRLLQTVRGVGYVLRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-43 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-49 50
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-37 46
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-42 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-40 45
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-37 44
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-38 44
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-34 44
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-37 43
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-34 42
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 42
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-37 42
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0347 Protein 5e-36 42
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 8e-32 41
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-25 41
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-55 55
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-39 46
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-45 44
Aazo_0389 YP_003720073.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-34 43