Gene Information

Name : EbC_09000 (EbC_09000)
Accession : YP_003740289.1
Strain : Erwinia billingiae Eb661
Genome accession: NC_014306
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1070976 - 1071650 bp
Length : 675 bp
Strand : +
Note : silverDB:661Eb01221

DNA sequence :
ATGAAAATTCTGGTGATTGATGATGAGCCCAAAGCCCGGGAATACATGCGCAGCGGCTTAACCGAATCTGGCTATGTGGT
TGATGTGGCGGTAAACGGCCGCGAAGGGCTGTTTATGGCGCAGGAATATCATTACGACCTGATCCTGCTGGACGTGATGA
TGCCGGAGCTGGATGGCTGGGAGGTGATGAAAACGCTGGATGCGCAGAATATCCCGGTTATTTTCCTCACCGCGAAAAGC
ACCGTCGAAGACCGGATCAAAGGGCTGGAACTGGGTGCCGACGACTATCTGGTCAAGCCTTTCTCGTTTGCCGAGCTGCT
GGCGCGGATCCGCACGGCACTGCGGCGCGGCGCGAACGTCAAGCGTGATGAGCTGCTGCAGGTCGGTGATTTGCAGCTGG
ACAGGGCGAAACGTCGCGTCGAACGGGCCGGGGTGCGCATCGATCTGACCAACAAAGAATTCAATTTGCTGCAGCTGTTT
ATGCTGAATCCCGGCCAGGTGATGAGCCGCACGCTGATTGCCTCGCGGGTGTGGGATATGAATTTCGACAGTGATACCAA
CGTGGTCGACGTGGCCGTTCGCCGGCTGCGGCAGAAGGTGGACGAGCCCTTTGCCACGCCGCTGATCCACACCGTTCACG
GCGTCGGTTATCGCTGTGAAGGTGACGGATGCTGA

Protein sequence :
MKILVIDDEPKAREYMRSGLTESGYVVDVAVNGREGLFMAQEYHYDLILLDVMMPELDGWEVMKTLDAQNIPVIFLTAKS
TVEDRIKGLELGADDYLVKPFSFAELLARIRTALRRGANVKRDELLQVGDLQLDRAKRRVERAGVRIDLTNKEFNLLQLF
MLNPGQVMSRTLIASRVWDMNFDSDTNVVDVAVRRLRQKVDEPFATPLIHTVHGVGYRCEGDGC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-56 57
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-56 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-61 60
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0083 Protein 4e-62 58
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-61 57
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-55 56
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-57 54
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0347 Protein 4e-55 53
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-55 53
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 9e-36 42
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 9e-36 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator VFG0596 Protein 6e-57 56
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-34 46
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-38 44
EbC_09000 YP_003740289.1 two component heavy metal response transcriptional regulator VFG1386 Protein 4e-35 41