Gene Information

Name : czcR (RPSI07_mp0425)
Accession : YP_003749414.1
Strain :
Genome accession: NC_014310
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 556568 - 557242 bp
Length : 675 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 10198000, 9044283; Product type r : regulator

DNA sequence :
ATGCGACTGCTCATCGTCGAAGACGAGCCCAAGGCGGGCGACTATCTCCTGAAGGGCCTGACGGAATCCGGCTTCGTGGC
CGACCTCGCCCGCTCCGGCCCCGATGGCCTCTACCAGGCCATGGAACACGACTACGACCTGATCGTGCTCGACGTCATGC
TGCCCGGCATGGACGGCTGGCAGGTCATCCGCGAGCTGCGCCGCCACAAGACCACGCCGGTGCTCTTCCTCACCGCCCGC
GACGAGCTGTCCGACCGCCTGAAGGGCCTGGAGCTGGGCGCCGACGATTACCTCGTCAAACCCTTCGCCTTTGCGGAGCT
GGTGGCGCGCGTGCACACCATCCTGCGGCGCGGGCCGATGCGCGAGAGCGAGGTCCTCGAAATCGCCGACCTGACCATCG
ACACCATCAAGCGCCGCGTCACGCGCGCCGGCCGCAGGATCGACCTGACCGCGAAGGAATACGCGCTGCTGCACCTGCTG
GCGCGCCGCACGGGCGAGGTGCTGTCGCGCTCGCTGATCTCCTCGCAGGTGTGGGACGTGAACTTCGACAGCAACACCAA
CGTGGTCGACGTCGCCATCCGCCGCCTGCGCGCCAAGGTGGACGACCCGTTCGAACACAAACTGATCCACACGCTGCGCG
GCATGGGCTACGTGCTGGACACGGCCGCCCGATGA

Protein sequence :
MRLLIVEDEPKAGDYLLKGLTESGFVADLARSGPDGLYQAMEHDYDLIVLDVMLPGMDGWQVIRELRRHKTTPVLFLTAR
DELSDRLKGLELGADDYLVKPFAFAELVARVHTILRRGPMRESEVLEIADLTIDTIKRRVTRAGRRIDLTAKEYALLHLL
ARRTGEVLSRSLISSQVWDVNFDSNTNVVDVAIRRLRAKVDDPFEHKLIHTLRGMGYVLDTAAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-59 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-58 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0125 Protein 3e-73 68
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0197 Protein 6e-71 68
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0083 Protein 2e-68 65
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0638 Protein 3e-61 64
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0308 Protein 1e-65 63
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0111 Protein 2e-65 60
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA BAC0347 Protein 1e-57 55
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_007793.3914065.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002758.1121390.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_010079.5776364.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002952.2859858.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_007622.3794948.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_003923.1003417.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_013450.8614146.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002951.3238224.p0 Protein 3e-42 44
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA AE015929.1.gene1106. Protein 2e-36 43
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA AE000516.2.gene3505. Protein 3e-31 42
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002952.2859905.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002758.1121668.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_009641.5332272.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_013450.8614421.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_007793.3914279.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_003923.1003749.p0 Protein 3e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002745.1124361.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_009782.5559369.p0 Protein 2e-32 41
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA NC_002951.3237708.p0 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA VFG0596 Protein 5e-60 57
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA VFG1389 Protein 8e-33 45
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA VFG1386 Protein 4e-36 43
czcR YP_003749414.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czcCBA VFG1390 Protein 5e-38 42