Gene Information

Name : Dehly_1189 (Dehly_1189)
Accession : YP_003758804.1
Strain : Dehalogenimonas lykanthroporepellens BL-DC-9
Genome accession: NC_014314
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1167515 - 1168204 bp
Length : 690 bp
Strand : +
Note : KEGG: det:DET0135 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCAAAATAAAGTATTAATTGTTGAGGACGACCCTAATCTACTGAAAACTCTCAAATACAACCTGAACAAAGAGAGTTA
TGATGTGGTCATTGCTGCGGATGGGGAGCAGGCACTTGAGGTAGCTCGTAAGGAAAAACCTGATCTTATCTTGCTCGATA
TTATGTTGCCGAAACTTAGTGGGTTTGAAGTATGCCGCATCCTCCGCAAGGAAATGAATTCACCTATTTTAATGTTAACT
GCGAAAGCTGATGAGACTGACAAAATAGTTGGGCTTGAAATTGGGGCCGATGACTATGTCACCAAGCCTTTTAGCATGAG
AGAGCTGATAGCTCGCGTTAGAGCCATGCTTCGCAGGACACAAATTATGGAGACGAAACCGTCCGAAGATAAAATTATTA
AAATTGGAGACATCAGAGTTGATATAGATCGGCATCAGGCTTCATTAGCGGAAGTTATCCTGGAACTGAAACCAAAAGAG
TTTGATTTATTGGCTTTTCTAGCTAGAAACAAGGGTTTGGTTTTTAGCAGAGAGCAGCTGTTAGAAAAAGTATGGGGTTA
TGATTATGCTGGCGATACCAGGACGGTTGACGTGCACATCCGGTGGTTAAGGCAGAAAATTGAAAATGACCCGGGTAACC
CAACCTATCTCGTAACTGTCAGGGGCACAGGTTATAAACTGGAAGGTTAG

Protein sequence :
MQNKVLIVEDDPNLLKTLKYNLNKESYDVVIAADGEQALEVARKEKPDLILLDIMLPKLSGFEVCRILRKEMNSPILMLT
AKADETDKIVGLEIGADDYVTKPFSMRELIARVRAMLRRTQIMETKPSEDKIIKIGDIRVDIDRHQASLAEVILELKPKE
FDLLAFLARNKGLVFSREQLLEKVWGYDYAGDTRTVDVHIRWLRQKIENDPGNPTYLVTVRGTGYKLEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-52 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-49 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-53 52
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-45 49
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-48 48
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-50 48
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-37 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 1e-40 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-39 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-39 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-34 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-38 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-35 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-35 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-35 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-35 43
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-33 42
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-38 42
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-35 42
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-34 42
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-34 42
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-33 41
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-33 41
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 8e-30 41
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-38 47
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-38 41
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator VFG1702 Protein 8e-38 41
Dehly_1189 YP_003758804.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-38 41