Gene Information

Name : Dehly_0267 (Dehly_0267)
Accession : YP_003757913.1
Strain : Dehalogenimonas lykanthroporepellens BL-DC-9
Genome accession: NC_014314
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 257499 - 258188 bp
Length : 690 bp
Strand : -
Note : KEGG: det:DET1058 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAACATGGCAAAAAAGATTCTGGTCATCGACGACGAACGGAAAATCATAGATATCGTCCGAGCCTACCTGGAAAAGGA
AGGCTACCGGGTGCTGACGGCCACCGACGGCGAGGCCGGGCTGAAGGTCTGGCGTCAGGAGAGACCGGACCTGGTGGTGC
TGGACCTGATGATGCCCAAATTGTCGGGCAACGATGTCTGCCGAATCATCCGGCAGGAATCCGAGACACCGGTCATCATG
CTGACCGCCCGGGACGAACTGACCGACAAGATAGTCGGCCTGGAACTGGGTGCCGATGATTATGTCACCAAGCCCTTCGA
AGGCCGTGAACTGGTGGCCCGCATCAAGGCCGTCCTGCGCCGCACCGAACATAGAACCTTCGCCCCGGTACTCCGGGTGG
GTGAACTGACGGTAGACGTCGAGCGTCGCCAGGCCGACATCGGTGGTAAGGTTATCGAACTGACCACCACCGAATTCGAC
CTGTTGAAACTGATGGCCGCCAACCCGGGAAGGGTGTTTTCCCGTTCGGAAATACTGGACCGGCTTCAGGGTGACACCTA
CGAGGGTTACGAGCGCACCATCGACAGCCACATCAAGAACCTGCGCCGCAAGATAGAACCCGACCCCGACCGGCCGAGCT
ATATCCAGACGGTGTACGGCGCCGGCTACCGGCTGGAGGCCGGGACGTGA

Protein sequence :
MNMAKKILVIDDERKIIDIVRAYLEKEGYRVLTATDGEAGLKVWRQERPDLVVLDLMMPKLSGNDVCRIIRQESETPVIM
LTARDELTDKIVGLELGADDYVTKPFEGRELVARIKAVLRRTEHRTFAPVLRVGELTVDVERRQADIGGKVIELTTTEFD
LLKLMAANPGRVFSRSEILDRLQGDTYEGYERTIDSHIKNLRRKIEPDPDRPSYIQTVYGAGYRLEAGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-39 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-39 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 1e-44 45
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-31 45
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-44 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-44 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 7e-37 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-40 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator BAC0533 Protein 7e-37 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 7e-37 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-39 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-42 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 6e-43 44
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-36 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-36 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 5e-44 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-38 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-39 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 2e-40 42
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-30 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-32 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-39 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 6e-34 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-31 41
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-39 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-39 43
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-31 42
Dehly_0267 YP_003757913.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-36 42