Gene Information

Name : rrp5 (LEGAS_1404)
Accession : YP_003772871.1
Strain : Leuconostoc gasicomitatum LMG 18811
Genome accession: NC_014319
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1454096 - 1454785 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGAGTAAAGTATTGATTGTTGAAGATGAAGAAAACTTGGCAAAGTTTGTAGGCCTTGAATTAAAGCATGAAGGCTATGA
AGTTGAAACAGTTTTAGATGGTCGTTCGGGATTGGATGCAGCATTAGAGAATAACTATGATGTTATTTTGCTTGATTTAA
TGTTGCCAGAACTAAATGGGCTAGAGGTTGCTCGTCGTTTGCGCGAATCTAAGAAAACGCCAATCATCATGATGACTGCA
CGTGATTCAGTTATTGATCGCGTTTCAGGATTAGATTATGGGGCGGATGATTACTTGGTTAAGCCCTTTGCTATTGAAGA
ACTGTTAGCACGAATACGGTCACTACTCCGTCGTATTGCAATTGAGACGGAGTCTAACGATAAGCATCGCTCAATTATTA
ATTTCAAAGACTTGCGTATTGAAAAAGAGAATCGTATTGCCCGTCGTGATGATCAAATCATTAATTTAACAAAACGTGAG
TATGATTTGTTATTGACATTGGTAGAAAACATTAACATCGTTCAATCACGTGAACAACTGCTAAAAGAAGTTTGGGGTTT
TGATTCAGAGGTCGAAACGAACGTTGTTGATGTCTATATTAGATACTTACGTAATAAGATTGATGATCCAGAAAGTAAAG
CATCTTATATCCAGACAGTTCGTGGTACTGGCTATGTCATGCGTAGCTAA

Protein sequence :
MSKVLIVEDEENLAKFVGLELKHEGYEVETVLDGRSGLDAALENNYDVILLDLMLPELNGLEVARRLRESKKTPIIMMTA
RDSVIDRVSGLDYGADDYLVKPFAIEELLARIRSLLRRIAIETESNDKHRSIINFKDLRIEKENRIARRDDQIINLTKRE
YDLLLTLVENINIVQSREQLLKEVWGFDSEVETNVVDVYIRYLRNKIDDPESKASYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp5 YP_003772871.1 two-component response regulator HE999704.1.gene1528. Protein 5e-66 67
rrp5 YP_003772871.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-49 55
rrp5 YP_003772871.1 two-component response regulator AE015929.1.gene1106. Protein 1e-44 54
rrp5 YP_003772871.1 two-component response regulator NC_012469.1.7686381. Protein 5e-35 42
rrp5 YP_003772871.1 two-component response regulator BAC0125 Protein 2e-30 41
rrp5 YP_003772871.1 two-component response regulator NC_012469.1.7685629. Protein 4e-38 41
rrp5 YP_003772871.1 two-component response regulator HE999704.1.gene2815. Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
rrp5 YP_003772871.1 two-component response regulator VFG1389 Protein 2e-32 45
rrp5 YP_003772871.1 two-component response regulator VFG1390 Protein 9e-34 44
rrp5 YP_003772871.1 two-component response regulator VFG0596 Protein 1e-32 42