Gene Information

Name : cpfrc_01461 (cpfrc_01461)
Accession : YP_003783861.1
Strain : Corynebacterium pseudotuberculosis FRC41
Genome accession: NC_014329
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3655
EC number : -
Position : 1597992 - 1598204 bp
Length : 213 bp
Strand : +
Note : -

DNA sequence :
GTGACCATCACGTTCAAACCTCTGTGGAAACTCCTTATCGACCGAGAAATGACCAAAGAAGACCTACGCATCGCAACCGG
CTTATCAGCTGCGACCATCGCCAAGATGGGTAAAGACGGCAACGTCACCACAGAGGTTCTTGCCCGAATATGTACGGCAT
TAACGGTAGACATCAATGACATCTGCGAAGCCACCAAGGAGCCAAAGAAATGA

Protein sequence :
MTITFKPLWKLLIDREMTKEDLRIATGLSAATIAKMGKDGNVTTEVLARICTALTVDINDICEATKEPKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cpfrc_01461 YP_003783861.1 hypothetical protein Not tested PiCp 5 Protein 2e-26 100
Cp1002_1456 YP_005681720.1 hypothetical protein Not tested PiCp 5 Protein 6e-26 99
CpC231_1455 YP_005683818.1 hypothetical protein Not tested PiCp 5 Protein 5e-26 99
CpI19_1462 YP_005685904.1 hypothetical protein Not tested PiCp 5 Protein 5e-26 99
SP_1030 NP_345505.1 hypothetical protein Not tested PPI-1 Protein 1e-07 41
SPN23F_09520 YP_002510935.1 regulatory protein Not tested PPI-1 Protein 1e-07 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cpfrc_01461 YP_003783861.1 hypothetical protein DQ212986.1.gene3.p01 Protein 7e-12 50