Gene Information

Name : Olsu_1502 (Olsu_1502)
Accession : YP_003801481.1
Strain : Olsenella uli DSM 7084
Genome accession: NC_014363
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1721724 - 1722410 bp
Length : 687 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterProIPR001789:IPR011991:IPR005829:IPR001867:IPR 011006; KEGG: ccu:Ccur_00280 response regulator with CheY-like receiver domain protein a

DNA sequence :
ATGACTAGGATCCTGGTCGTAGAGGACGAAGAGAAGATCGCGCGCTTTGTCGAGCTCGAGCTCCGTCACGAGGGCTACGA
GGTCGACAAGGCCGCGGACGGGCGCTCTGGCGTGGAGGCGGCCCTCTCGTCCGACTATGACCTGGTCCTCCTTGACGTGC
TGCTGCCGCAGCTCAACGGCATGGAGGTCCTGCGCCGCCTGCGCCGTCAGAAGGACACCCCGGTCATCCTGCTGACCGCA
CGCGATGCCGTGATGGACAAGGTGGCGGGCCTCGACGCCGGGGCGGACGACTACATCACCAAGCCCTTTGCCATCGAGGA
GCTCCTGGCACGCATCCGCGTGACGCTCAAGCACCGTGAGTCGGGCCAGCTGCCTTCGACGTCGTCCGCCACGCTTGCGG
CCTGCGGCGTCACGCTCGACCCAGATCGTCACGAGGTCCTCGTCCAAGGTGAGCCAGTGGCCCTCACCAACAGGGAATTC
GAGGTCCTGCACGCCCTCATGGCGCACAAGGGGGTCGTCCTCACCCGCGCGCGCCTGGCGAGCGAGGCGCTGGGGTACGA
GTACGTGGGCGAGACCAACAACGTCGACGTCCACATCGCCCACCTGCGCTCCAAGATCGACGATCGCTTTGGCATCAAGC
TGCTTACGACGGTCCGTGGGGTGGGGTATGTCGTCCGCGAATCCTGA

Protein sequence :
MTRILVVEDEEKIARFVELELRHEGYEVDKAADGRSGVEAALSSDYDLVLLDVLLPQLNGMEVLRRLRRQKDTPVILLTA
RDAVMDKVAGLDAGADDYITKPFAIEELLARIRVTLKHRESGQLPSTSSATLAACGVTLDPDRHEVLVQGEPVALTNREF
EVLHALMAHKGVVLTRARLASEALGYEYVGETNNVDVHIAHLRSKIDDRFGIKLLTTVRGVGYVVRES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-36 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-39 51
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-39 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-34 47
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family BAC0197 Protein 8e-35 46
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family BAC0125 Protein 7e-34 44
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family BAC0308 Protein 5e-34 43
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-37 43
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-36 42
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-34 42
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-30 42
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 6e-27 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-37 45
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family VFG1389 Protein 9e-34 44
Olsu_1502 YP_003801481.1 two component transcriptional regulator, winged helix family VFG1390 Protein 3e-33 42