Gene Information

Name : Olsu_1769 (Olsu_1769)
Accession : YP_003801737.1
Strain : Olsenella uli DSM 7084
Genome accession: NC_014363
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2033538 - 2034227 bp
Length : 690 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867:IPR011006; KEGG: apv:Apar_0090 two component transcriptional regulator, winged helix family; PFAM: response reg

DNA sequence :
TTGAAGATCCTCGTGGTCGAAGACGAGCGTGAACTTCTCGAGTCTATCGGTGAAGGTCTCAGAATAGACGGATATTATGT
CGACCTCCTTGACAATGGGACCGAAGCGCTTGAGATGGCCCAGATAGAGCCCTATGACCTGATCCTGCTGGACCTCAACC
TCCCTGGCATCGATGGGCTCGAACTGCTGCGGACGCTGAGGGCCCAGCATTCGGAGACCAAAGTGCTCATACTCTCCGCT
CGCTCGGCGGTCTCCGACCGTATCGTTGGCCTGGACGCAGGGGCAGACGACTACCTTGTGAAGCCCTTCGCCTTTGGAGA
GCTCGAGGCCCGGGTGCGCAACCTCCTGAGACGCGAGTACACGCAGGGGGAGACGTTCCTCGACTGCGGGGACCTTCGCT
TTGACACGACCACCCGCAGGCTCAGCGCCAAGGGCGTCGAGATCAGCCTTACGAAGAAGGAGACCGCGATACTGGAGTAC
CTCATGCGCCACAAGGGCCGCGTGGTAAGCAGCGAGGAGCTGTTGTCACATGCTTGGGACAGCAGCGTCGACCCGTTCAG
CAACTCGGTGAGGGTGCACATCTGCTCGCTCAGAAAGAAGCTGCGATCCGTGCTCGGGTGCGACCCCATATCCAACAAGA
TCGGAGAGGGCTACTATCTGACGGAGAAGGACGACCATGGTGGGCGTTAG

Protein sequence :
MKILVVEDERELLESIGEGLRIDGYYVDLLDNGTEALEMAQIEPYDLILLDLNLPGIDGLELLRTLRAQHSETKVLILSA
RSAVSDRIVGLDAGADDYLVKPFAFGELEARVRNLLRREYTQGETFLDCGDLRFDTTTRRLSAKGVEISLTKKETAILEY
LMRHKGRVVSSEELLSHAWDSSVDPFSNSVRVHICSLRKKLRSVLGCDPISNKIGEGYYLTEKDDHGGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family BAC0083 Protein 8e-35 45
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family BAC0638 Protein 4e-29 42
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family BAC0125 Protein 7e-32 42
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family BAC0487 Protein 2e-25 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-30 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-32 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-29 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family VFG0473 Protein 6e-31 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-32 41
Olsu_1769 YP_003801737.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-28 41