Gene Information

Name : Deba_1066 (Deba_1066)
Accession : YP_003807028.1
Strain : Desulfarculus baarsii DSM 2075
Genome accession: NC_014365
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1192198 - 1192881 bp
Length : 684 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR011006:IPR001789:IPR001867:IPR018480; KEGG: sfu:Sfum_0707 two component transcriptional regulator; PFAM: response regulator rece

DNA sequence :
ATGAACGCATCGACCATTCTGGTGGTTGAGGACGAACAAGACATCATCGACTTGGTCGAGTTCAATCTGCGCCAAGCCGG
GTTCAACGTCATCAAGGCCACCAACGGCCTGGACGGCCTGCGCCTGGCCAAGGAAAAAAAGCCGGCCCTGCTGGTGTTGG
ACCTGATGCTGCCGGGCCTGGAGGGCCAGGAAGTCTGCCGCCGCCTGAAGCAGGGTGACGACACCAGGCGCATCCCGGTG
CTGATGCTCACCGCCCTGGCCAGCGAGACCGACCGCATCGTCGGCTTCGAACTGGGGGCCGATGATTATCTGGCCAAGCC
CTTCAGCCCACGCGAACTGGTCTTGCGCGTGCGGGCCATTTTGCGACGGCAGACCGGCCCGGAGGAACAGAGCGCGCCTT
TGCGCAAAGACGCGCTGGTTATCCACCCAGACCGCTTCGAAGTGCGCATCGACGACGAAATGGTCGCCCTGACCGCCACC
GAGTTCAAGCTCCTGCATCATCTGGTGGCCAACGCCGGCCGCGTGCAGACCAGGCAGCAGCTTCTGGAGCACGTCTGGGG
CTACGAATACGACGGCTACGCCCGCACCGTCGACACCCATGTGCGCCGGTTACGCAAAAAAATCGGCCCCTTGAGCGACG
ACATCGAGACCATCCGGGGCATCGGCTATCGCTACAAGGAGTGA

Protein sequence :
MNASTILVVEDEQDIIDLVEFNLRQAGFNVIKATNGLDGLRLAKEKKPALLVLDLMLPGLEGQEVCRRLKQGDDTRRIPV
LMLTALASETDRIVGFELGADDYLAKPFSPRELVLRVRAILRRQTGPEEQSAPLRKDALVIHPDRFEVRIDDEMVALTAT
EFKLLHHLVANAGRVQTRQQLLEHVWGYEYDGYARTVDTHVRRLRKKIGPLSDDIETIRGIGYRYKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 8e-48 49
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 6e-42 44
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-44 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 6e-26 43
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family BAC0125 Protein 7e-32 42
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 5e-32 42
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-42 41
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 5e-28 41
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 9e-29 41
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family BAC0533 Protein 5e-28 41
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 9e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Deba_1066 YP_003807028.1 two component transcriptional regulator, winged helix family VFG0596 Protein 5e-30 41