Gene Information

Name : Toce_2236 (Toce_2236)
Accession : YP_003826570.1
Strain : Thermosediminibacter oceani DSM 16646
Genome accession: NC_014377
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2237886 - 2238575 bp
Length : 690 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cth:Cthe_2333 two component transcriptional regulator; PFAM: response regulator receiver; transcriptiona

DNA sequence :
ATGGGTCAAAAGATACTGGTGGTGGACGACGAAAAGCCCATAGTCGATATACTGAAATATAATCTTGCCAAGGAAGGATA
CGAAGTAATCGCCGCTTACGACGGCGAAGAGGCAATCGAGGTAGCCTTTTCCCAAAACCCGAACCTCATACTGCTGGATG
TAATGCTGCCCAAGCAGGACGGATTTCAGGTGTGTAAGAAGTTGAGGGAAAAACTCGCCTGTCCCATCATCATGCTGACA
GCTAAGGGTGAGGAAGTGGACAAGGTCCTGGGCCTGGAGCTCGGGGCTGACGATTACGTAACCAAGCCCTTCGGCATGAG
GGAGCTCATGGCCCGGATTAAGGCAAACTTGAGGAGGCTGACGCTTTCAAATCCCGTTGAAGAACAAAAGCTATTGAAGG
TGAAGGACCTGGAAATAGACCTTGCAAGCTTTCAGGTGAGAAAAAAGGGCAATACCTTGGAGCTCACCTTCAGGGAGTTC
GAGCTTTTGAAATTCCTGGCCGCCCAGCCGGGGCAGGTTTTTTCAAGGGAAAAGCTATTAGAAGAAGTCTGGGGATACGA
ATACTACGGCGATATCCGCACCGTCGACGTAACCATCAGGAGGCTCAGGGAAAAGATAGAAGATGACCCATCCAATCCCT
CATATATAAAGACGAAGCGAGGGGTGGGATATTATTTTAACAGAAACTAG

Protein sequence :
MGQKILVVDDEKPIVDILKYNLAKEGYEVIAAYDGEEAIEVAFSQNPNLILLDVMLPKQDGFQVCKKLREKLACPIIMLT
AKGEEVDKVLGLELGADDYVTKPFGMRELMARIKANLRRLTLSNPVEEQKLLKVKDLEIDLASFQVRKKGNTLELTFREF
ELLKFLAAQPGQVFSREKLLEEVWGYEYYGDIRTVDVTIRRLREKIEDDPSNPSYIKTKRGVGYYFNRN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-54 58
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-48 55
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-48 54
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-48 54
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-45 54
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-40 47
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 1e-38 46
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 3e-26 46
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 8e-35 46
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 3e-26 46
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-38 46
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-35 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 6e-37 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-35 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 6e-26 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 6e-26 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family BAC0533 Protein 6e-26 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-21 45
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 5e-36 44
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 4e-33 43
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 3e-30 43
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 1e-31 43
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 1e-35 43
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-30 43
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-27 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-33 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 3e-28 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-28 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 1e-31 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-29 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 8e-36 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 2e-28 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family BAC0039 Protein 1e-28 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-27 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 1e-28 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 9e-29 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family VFG1389 Protein 4e-24 42
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family VFG1390 Protein 3e-32 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-31 41
Toce_2236 YP_003826570.1 two component transcriptional regulator, winged helix family VFG1702 Protein 3e-31 41