Gene Information

Name : Toce_0967 (Toce_0967)
Accession : YP_003825352.1
Strain : Thermosediminibacter oceani DSM 16646
Genome accession: NC_014377
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 958748 - 959446 bp
Length : 699 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: chy:CHY_2047 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional regulato

DNA sequence :
ATGGCGAAGGAAAAGATACTCGTCGTCGACGACGAGCCCAATATTGTGGAGCTGGTGAGGTTCAACCTTGAAAACAGCGG
TTTTAAAGTAATAACCGCATCCGACGGTCAGCAGGCCTTGGATCTAGTTCAAAAAGAACAACCCGATCTTGTAATACTGG
ATATAATGCTACCGGGCATAGACGGATTGGAAGTTTGCCGTATTTTTCGACGGCAGCGGGCTACCAGGGATATCCCCGTT
ATACTGTTGACGGCAAAGACGGAAGAAATCGATAAGGTGCTTGGGCTTGAAATGGGAGCCGATGATTACATCACAAAACC
GTTCAGCCCCCGCGAGCTGGTAGCAAGGGTAAAAGCGGTATTAAGGAGGGCCGACAAGGTCGAAAGGTCTGATAAGATTA
TTAAAGCAGGCCCTATAACCATAGACGTAGAAAGGCACGAGGTGTTTGTAGAGGGGGAGAGAAAAGATTTTACACCGAAG
GAGTTTGAACTTTTAAGGCTCCTGGCTTCCAATCCAGGCAAGGTTTTTTCGCGGGAATATCTCCTGGAAAATATATGGGG
CTATGATTATCTTGGAGATACCAGGACGGTGGATGTTCACATCAGGCATCTGAGGCAGAAAATCGAAAGGAATTCGGATA
CGCCCCAATTTATCGAGACGGTAAGGGGTATCGGGTACAAGTTTAATGAGCCGGAGTGA

Protein sequence :
MAKEKILVVDDEPNIVELVRFNLENSGFKVITASDGQQALDLVQKEQPDLVILDIMLPGIDGLEVCRIFRRQRATRDIPV
ILLTAKTEEIDKVLGLEMGADDYITKPFSPRELVARVKAVLRRADKVERSDKIIKAGPITIDVERHEVFVEGERKDFTPK
EFELLRLLASNPGKVFSREYLLENIWGYDYLGDTRTVDVHIRHLRQKIERNSDTPQFIETVRGIGYKFNEPE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-46 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-46 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-35 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-58 53
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-52 51
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 5e-59 51
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-51 50
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-54 49
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-47 48
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-48 48
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-40 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-47 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 7e-42 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-42 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family BAC0039 Protein 2e-42 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-42 46
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 2e-48 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 2e-48 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 2e-41 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-41 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family BAC0596 Protein 2e-41 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 2e-40 44
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 1e-39 44
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 2e-40 44
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 1e-40 44
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 4e-39 44
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 1e-40 43
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 3e-36 43
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-34 42
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 1e-35 42
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 2e-37 42
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 3e-35 41
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP001581.1.gene280.p Protein 4e-36 41
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 1e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family VFG1563 Protein 1e-46 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family VFG1702 Protein 4e-47 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-34 45
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-40 43
Toce_0967 YP_003825352.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-35 42