Gene Information

Name : Micau_6165 (Micau_6165)
Accession : YP_003839234.1
Strain : Micromonospora aurantiaca ATCC 27029
Genome accession: NC_014391
Putative virulence/resistance : Virulence
Product : response regulator receiver
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6880319 - 6881002 bp
Length : 684 bp
Strand : -
Note : KEGG: stp:Strop_4477 response regulator receiver; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
GTGACCACCGCCGCCCCGCCCGGGCTCGTCCTCGTGGTGGAGGACGAGCCGGCCATCGCCGACCTGGTCCGGCTCTACCT
GACCCGGGACGGGTTCGGCGTACACCTGGAACGTGACGGCGAGGCCGGGCTGGCCGCCGCGCGGCGCCTGCGCCCGGTGG
CCTGCGTGCTCGACATCGCGCTGCCCGGCCTGGCCGGCACCGAGATCTGCCGCCGCCTGCGCGCGGCGGGTGACTGGACG
CCTGTCATCTTCCTCACCGCCCGCGACGACGAGGTGGACCGCGTCGTCGGGCTGGAACTGGGCGCTGACGACTACGTCAC
CAAGCCGTTCAGCCCGCGCGAACTGCTCGCCCGGCTGCGGGCGGTGCTGCGCCGCACCGCCGGCGTGCCCGCCGAGCAGC
CCCGCACGCTCGGCGCCGTCACACTCGACCCGGCCCGGCGGACCGTGACGGCCGGCGGTACGCCGGTGCAGCTCACCTCC
ACCGAGTTCGACCTGCTCGCGCACCTGATGGCGCGGCCCGGCCGGGTGTTCACACGGGAGGAGCTGCTGGCGGGCGTGTG
GGGGTACGCGGCGCACGCCGGCACCCGGACCGTCGACGTGCACGTGGCGCAGGTGCGGGCCAAACTCGGCCCGGACAGCG
TGATCCGCACCCATCGGGGCGTCGGGTACGCCGCCGATGCCTGA

Protein sequence :
MTTAAPPGLVLVVEDEPAIADLVRLYLTRDGFGVHLERDGEAGLAAARRLRPVACVLDIALPGLAGTEICRRLRAAGDWT
PVIFLTARDDEVDRVVGLELGADDYVTKPFSPRELLARLRAVLRRTAGVPAEQPRTLGAVTLDPARRTVTAGGTPVQLTS
TEFDLLAHLMARPGRVFTREELLAGVWGYAAHAGTRTVDVHVAQVRAKLGPDSVIRTHRGVGYAADA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-20 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-20 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Micau_6165 YP_003839234.1 response regulator receiver AE000516.2.gene3505. Protein 6e-34 46
Micau_6165 YP_003839234.1 response regulator receiver NC_012469.1.7686381. Protein 8e-34 45
Micau_6165 YP_003839234.1 response regulator receiver NC_002758.1121390.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_010079.5776364.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_002952.2859858.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_007622.3794948.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_003923.1003417.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_013450.8614146.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_002951.3238224.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver NC_007793.3914065.p0 Protein 7e-28 43
Micau_6165 YP_003839234.1 response regulator receiver CP000675.2.gene1535. Protein 2e-28 43
Micau_6165 YP_003839234.1 response regulator receiver HE999704.1.gene1528. Protein 5e-26 42
Micau_6165 YP_003839234.1 response regulator receiver BAC0197 Protein 3e-21 42
Micau_6165 YP_003839234.1 response regulator receiver BAC0308 Protein 5e-21 42
Micau_6165 YP_003839234.1 response regulator receiver AE015929.1.gene1106. Protein 8e-24 41
Micau_6165 YP_003839234.1 response regulator receiver BAC0125 Protein 2e-23 41
Micau_6165 YP_003839234.1 response regulator receiver CP001485.1.gene721.p Protein 5e-23 41
Micau_6165 YP_003839234.1 response regulator receiver NC_002952.2859905.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_002951.3237708.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_003923.1003749.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_002758.1121668.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_009641.5332272.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_013450.8614421.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_007793.3914279.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_007622.3794472.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_002745.1124361.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver NC_009782.5559369.p0 Protein 1e-34 41
Micau_6165 YP_003839234.1 response regulator receiver BAC0638 Protein 5e-20 41
Micau_6165 YP_003839234.1 response regulator receiver U82965.2.orf14.gene. Protein 1e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Micau_6165 YP_003839234.1 response regulator receiver VFG1390 Protein 2e-29 44
Micau_6165 YP_003839234.1 response regulator receiver VFG0596 Protein 1e-20 42
Micau_6165 YP_003839234.1 response regulator receiver VFG1389 Protein 9e-21 42
Micau_6165 YP_003839234.1 response regulator receiver VFG0473 Protein 6e-18 41