Gene Information

Name : COB47_0270 (COB47_0270)
Accession : YP_003839603.1
Strain : Caldicellulosiruptor obsidiansis OB47
Genome accession: NC_014392
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 327127 - 327801 bp
Length : 675 bp
Strand : -
Note : KEGG: ate:Athe_0280 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAGAATTCTAATAGTAGAAGATCAGGAATCACTAGCACACACCATTGCAAGAAGACTTCAAGAAGTAGGCTATAGTAC
AGATATAACTTTTGACGGACAGGAAGGTCTTCATTTTGCAACGAGCACCAGCTATGACCTTATTATACTTGACATAATGC
TTCCTAAGATTGATGGCATCAACTTGCTGAAACTTATAAGATTAAAAGGAATCCAAACACCAGTACTTTGTTTGACTGCT
AAAGATTCAATAGAAGACAGAGTCATTGGACTTGATGCTGGTGCAGATGATTATCTTGTAAAGCCTTTTTCATTTGATGA
ACTTTTAGCAAGAATAAGAGCATTATTAAGAAGATATGCTCAAACAAGAGAACCAATAATCAAAGTAAAAGACCTTGTAA
TAGATACAAATTCTCACAAGGTCACAAGAGCAGGAAAGCTAATTGAGCTTACATCAAAAGAGTATTCTATTTTAGAATAT
CTTGCTAGAAATAAAGGCAGAGTCCTTACACGCTCTCAGATAGCCGAGCATGTATGGAATTATGATTTCGAAGGAACTTC
TAATATAGTTGATGTTTATATAAGGTATCTTCGTCGAAAAATTGATGATGGTTTCCCTGAAAAACTTATTTATACTATCC
GTGGTGTAGGATATATGTTGAGGGATGAAAAATGA

Protein sequence :
MRILIVEDQESLAHTIARRLQEVGYSTDITFDGQEGLHFATSTSYDLIILDIMLPKIDGINLLKLIRLKGIQTPVLCLTA
KDSIEDRVIGLDAGADDYLVKPFSFDELLARIRALLRRYAQTREPIIKVKDLVIDTNSHKVTRAGKLIELTSKEYSILEY
LARNKGRVLTRSQIAEHVWNYDFEGTSNIVDVYIRYLRRKIDDGFPEKLIYTIRGVGYMLRDEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-43 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-42 47
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-27 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-37 52
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-44 50
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-43 50
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-33 49
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-41 49
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-40 49
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-38 48
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-36 45
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-40 45
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-37 45
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-33 43
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-27 42
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 1e-25 41
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 1e-25 41
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-33 41
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-44 48
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator VFG0473 Protein 7e-27 42
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-41 42
COB47_0270 YP_003839603.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-36 42