Gene Information

Name : Clocel_1314 (Clocel_1314)
Accession : YP_003842832.1
Strain : Clostridium cellulovorans 743B
Genome accession: NC_014393
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1615984 - 1616673 bp
Length : 690 bp
Strand : +
Note : KEGG: aoe:Clos_0943 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver; transcriptional regulator domain-containing protein

DNA sequence :
ATGAAGGGGAAAATACTTGTTATAGAAGATGAAGTGAAAATTGCAAGATTCATAGAACTTGAGTTGAATTATGAAGGGTA
TGAGGTTGAAAAAGTTCATGATGGAAGAGATGGGTTTAAAATGGCTAAGGAAAATGATTATGATTTAATACTATTAGACA
TAATGCTTCCTTCTATGAATGGTATTGAAATACTGAGAAGACTAAGGGAAAGTTCTGATATCCCTGTAATCATGCTTACA
GCTAAAGATGAAACTATGGATAAGGTCATGGGACTTGACATGGGAGCAGATGATTATGTGACTAAACCTTTTGAGATTGA
AGAGTTGTTGGCAAGAATAAGGGTTGCTTTAAAAAGAAAGATAGTAGTTGTTAAAGAAAATACTTCTAACCTTATCAAGA
TTAAAAATCTTAGTATAGATTTAGAAAAGTATTCTGTTACTTTTAAATCAGAAGATATTGAATTAACTAAAAAAGAATTC
GATTTATTATTATATTTAGTAGAAAACAAAAACAAAGTATTGTCTAGAGATAAAATATTAGAAACTGTTTGGGGTTTTGA
TTACTTTGGAGATACAAATGTTGTTGATGTATATATAAGGTATCTTAGAAGTAAAATTGATGATAAGTATAAGGAGAAAT
ATATCTATACCGTAAGAGGTGTAGGATATGTTGTAAAAGATGAGAAATGA

Protein sequence :
MKGKILVIEDEVKIARFIELELNYEGYEVEKVHDGRDGFKMAKENDYDLILLDIMLPSMNGIEILRRLRESSDIPVIMLT
AKDETMDKVMGLDMGADDYVTKPFEIEELLARIRVALKRKIVVVKENTSNLIKIKNLSIDLEKYSVTFKSEDIELTKKEF
DLLLYLVENKNKVLSRDKILETVWGFDYFGDTNVVDVYIRYLRSKIDDKYKEKYIYTVRGVGYVVKDEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-45 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-50 52
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-42 50
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-38 45
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family BAC0308 Protein 5e-38 44
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family BAC0197 Protein 4e-38 44
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 4e-35 44
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-43 44
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-36 42
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-41 42
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-35 42
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 8e-34 42
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-39 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family BAC0347 Protein 4e-35 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 6e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 7e-38 41
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 6e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-37 43
Clocel_1314 YP_003842832.1 two component transcriptional regulator, winged helix family VFG1389 Protein 9e-38 42