Gene Information

Name : Tthe_1614 (Tthe_1614)
Accession : YP_003852207.1
Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571
Genome accession: NC_014410
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1611625 - 1612314 bp
Length : 690 bp
Strand : -
Note : KEGG: tex:Teth514_1155 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAAAATACTAGCAATAGATGACGAAGAAAAGATTTTAGATGTTATAAAAGCATATCTTGAGCGGGAAGGGTACTCTGT
ATTTACTGAGACAAACGGAGCAAATGCCATAAATACATTTAAAAGTCTGAAACCTGATTTAGTGATATTGGATTTAATGC
TTCCAGGATTGTCAGGTGAAGAGATATGCAGTAAGATAAGAGCTATATCAAAAGTACCAATTCTCATGCTGACAGCTAAG
GTAGAGGAAGATGATAAGGTATATGGATTTTCAATTGGTGCGGATGATTATCTTACAAAACCATTTAGCCCAAGAGAGCT
GACAATGAGAGTTAAAGCCATATTGAGGCGCACAAAGGATGATATGGCTTTAAATGATATATTTTCATTTAATGATGGTG
ATCTCGTAATTGATACAAGATCTTACGAGGTTAAGAAAAGTGGAGAGATTGTCAACTTGACTCCCAATGAATACAAGTTG
CTTACGGTGATGGCGCAAAACCCCAATAGAGTATTCACGCGAGGAGAGCTTATAGAAAAAGTTATGGGGTATGACTTTGA
AGGCTTTGATAGGACAATCGATGCGCATATAAAAAACCTTCGCCAAAAAATAGAGGATGACCCCAAAAATCCTGTATATA
TAAAAACTGTGTATGGTGCAGGTTATAAATTTGGTGAAGAAAATGCTTAG

Protein sequence :
MKILAIDDEEKILDVIKAYLEREGYSVFTETNGANAINTFKSLKPDLVILDLMLPGLSGEEICSKIRAISKVPILMLTAK
VEEDDKVYGFSIGADDYLTKPFSPRELTMRVKAILRRTKDDMALNDIFSFNDGDLVIDTRSYEVKKSGEIVNLTPNEYKL
LTVMAQNPNRVFTRGELIEKVMGYDFEGFDRTIDAHIKNLRQKIEDDPKNPVYIKTVYGAGYKFGEENA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_1614 YP_003852207.1 transcriptional regulator NC_012469.1.7685629. Protein 1e-40 49
Tthe_1614 YP_003852207.1 transcriptional regulator AE016830.1.gene1681. Protein 4e-39 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_012469.1.7686381. Protein 2e-41 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_007793.3914279.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_003923.1003749.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_002745.1124361.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_009782.5559369.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_002951.3237708.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_002758.1121668.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_009641.5332272.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_013450.8614421.p0 Protein 1e-42 46
Tthe_1614 YP_003852207.1 transcriptional regulator NC_002952.2859905.p0 Protein 1e-42 45
Tthe_1614 YP_003852207.1 transcriptional regulator NC_007622.3794472.p0 Protein 1e-42 45
Tthe_1614 YP_003852207.1 transcriptional regulator HE999704.1.gene2815. Protein 3e-42 45
Tthe_1614 YP_003852207.1 transcriptional regulator AE000516.2.gene3505. Protein 4e-40 44
Tthe_1614 YP_003852207.1 transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-37 43
Tthe_1614 YP_003852207.1 transcriptional regulator NC_014475.1.orf0.gen Protein 2e-35 42
Tthe_1614 YP_003852207.1 transcriptional regulator NC_005054.2598277.p0 Protein 2e-35 42
Tthe_1614 YP_003852207.1 transcriptional regulator AE015929.1.gene1106. Protein 9e-25 41
Tthe_1614 YP_003852207.1 transcriptional regulator AM180355.1.gene1830. Protein 3e-34 41
Tthe_1614 YP_003852207.1 transcriptional regulator NC_011586.7046392.p0 Protein 4e-33 41
Tthe_1614 YP_003852207.1 transcriptional regulator NC_010410.6002907.p0 Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_1614 YP_003852207.1 transcriptional regulator VFG1563 Protein 9e-38 41
Tthe_1614 YP_003852207.1 transcriptional regulator VFG1702 Protein 2e-38 41