Gene Information

Name : Tthe_1754 (Tthe_1754)
Accession : YP_003852335.1
Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571
Genome accession: NC_014410
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1748298 - 1749005 bp
Length : 708 bp
Strand : -
Note : KEGG: tpd:Teth39_0825 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
TTGACACATACAATTCTTGTAATCGAAGATGAAGCACATATTCTAGAACTTTTAAGGTATAATCTTGAGGCACAAGGATA
TAATGTCATACTTACTGATAACGGCAAAGAAGGACTTGAAAAATGCAGAGAATTAAGCCCTGATCTAGTTCTTTTAGATT
TAATGCTTCCTGATATAGATGGCATCGATGTCTGTAAAAAGATAAAATCTGATGAACACCTTAAAAACATTCCGATTATA
ATGTTAACCGCAAAAAGTGAAGAATTTGATAAAATACTGGGTTTAGAGCTGGGAGCAGATGATTACATTACAAAACCATT
TAGCATAAGAGAATTGCTGGCTAGGATAAAAGTTGTTTTAAGAAGATCAAAAAATGAAACCGAAGAAAATGAGATAATTA
AATTTGGAGACATTACTATAGATACCGAAAAGCACATAGTGTATAAAGGCAATGAAATTCTTGACCTTACTTTGAAGGAG
TTTGAACTGCTTAAACTTTTATCGAAAAACAGAGGTAAAGTTCTCACGCGTGATTATTTATTGGACAAGGTTTGGGGATA
TGAATACGCCGGTGAGACAAGAACGGTGGATGTCCATATAAGACATTTGAGAAAGAAGATTGAAGATGATGATAAGTTGC
CTGTGTACATTGAAACTGTTAGAGGTATCGGCTACAAATTAAAAGACATAGGTGAAGGCAATGCTTAA

Protein sequence :
MTHTILVIEDEAHILELLRYNLEAQGYNVILTDNGKEGLEKCRELSPDLVLLDLMLPDIDGIDVCKKIKSDEHLKNIPII
MLTAKSEEFDKILGLELGADDYITKPFSIRELLARIKVVLRRSKNETEENEIIKFGDITIDTEKHIVYKGNEILDLTLKE
FELLKLLSKNRGKVLTRDYLLDKVWGYEYAGETRTVDVHIRHLRKKIEDDDKLPVYIETVRGIGYKLKDIGEGNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 1e-24 42
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 2e-28 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 1e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002952.2859905.p0 Protein 8e-47 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002745.1124361.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_009782.5559369.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002951.3237708.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_003923.1003749.p0 Protein 9e-47 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002758.1121668.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_007622.3794472.p0 Protein 7e-47 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_009641.5332272.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_013450.8614421.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator NC_007793.3914279.p0 Protein 1e-46 55
Tthe_1754 YP_003852335.1 transcriptional regulator HE999704.1.gene2815. Protein 1e-41 53
Tthe_1754 YP_003852335.1 transcriptional regulator NC_012469.1.7686381. Protein 7e-45 50
Tthe_1754 YP_003852335.1 transcriptional regulator NC_012469.1.7685629. Protein 4e-36 48
Tthe_1754 YP_003852335.1 transcriptional regulator AE016830.1.gene1681. Protein 1e-38 46
Tthe_1754 YP_003852335.1 transcriptional regulator NC_003923.1003417.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_013450.8614146.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002951.3238224.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_007793.3914065.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002758.1121390.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_010079.5776364.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002952.2859858.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator NC_007622.3794948.p0 Protein 1e-27 45
Tthe_1754 YP_003852335.1 transcriptional regulator AE000516.2.gene3505. Protein 5e-32 45
Tthe_1754 YP_003852335.1 transcriptional regulator CP000034.1.gene2186. Protein 4e-24 44
Tthe_1754 YP_003852335.1 transcriptional regulator NC_002695.1.916589.p Protein 4e-24 44
Tthe_1754 YP_003852335.1 transcriptional regulator BAC0039 Protein 4e-24 44
Tthe_1754 YP_003852335.1 transcriptional regulator BAC0596 Protein 2e-23 44
Tthe_1754 YP_003852335.1 transcriptional regulator CP001138.1.gene2239. Protein 2e-23 44
Tthe_1754 YP_003852335.1 transcriptional regulator AE015929.1.gene1106. Protein 5e-24 43
Tthe_1754 YP_003852335.1 transcriptional regulator BAC0125 Protein 6e-25 43
Tthe_1754 YP_003852335.1 transcriptional regulator CP001918.1.gene3444. Protein 7e-24 43
Tthe_1754 YP_003852335.1 transcriptional regulator HE999704.1.gene1528. Protein 2e-26 42
Tthe_1754 YP_003852335.1 transcriptional regulator CP004022.1.gene1676. Protein 1e-22 42
Tthe_1754 YP_003852335.1 transcriptional regulator CP000647.1.gene2531. Protein 5e-25 42
Tthe_1754 YP_003852335.1 transcriptional regulator AM180355.1.gene1830. Protein 3e-23 41
Tthe_1754 YP_003852335.1 transcriptional regulator AF155139.2.orf0.gene Protein 1e-27 41
Tthe_1754 YP_003852335.1 transcriptional regulator FJ349556.1.orf0.gene Protein 1e-28 41
Tthe_1754 YP_003852335.1 transcriptional regulator CP000034.1.gene3671. Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_1754 YP_003852335.1 transcriptional regulator VFG1386 Protein 9e-31 41