Gene Information

Name : Tthe_1981 (Tthe_1981)
Accession : YP_003852548.1
Strain : Thermoanaerobacterium thermosaccharolyticum DSM 571
Genome accession: NC_014410
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1974163 - 1974840 bp
Length : 678 bp
Strand : -
Note : KEGG: mta:Moth_1478 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAGGATATTAGTTGTTGATGATGAACCATATTTGACAGACTTATTAAATAAGGCATTAAAAGAAGAAGGATACAGCGT
CGATATTGCCCAAAATGGTATTGACGGTATGGAATGTGCTAAAATGAATGTTTATGATGTTATTATACTTGATATAATGT
TACCAGAGATTGATGGTATTCAAATTTTAAAAAATTTGAGGAATATGAATATTAATACGCCTATACTTATGCTAACAGCA
AAAGATGCTCTAGATGATAAGGTAAAAGGACTTGATACAGGTGCTGATGATTATATGACAAAACCTTTTGAGCTATCTGA
ACTAACGGCTCGAATCAGAGCATTATTAAGAAGAGAACAACCATCAAAATCTCCTATATTAAAAATTGCAGATCTTGAAG
TAAATACACTTACACATGATGTAAGACGCGGTGGCAAAATAATTACTTTGACAAGTAAAGAATATTCTTTGCTTGAATAT
ATGATGAGAAATTCAGGTCGTGTACTAACCCGTTCACAAATAGTGGATCATGTGTGGGGGTATGAATTTGATGGTTTGTC
AAATATAATTGATGTATATATCAGATATTTAAGGAAAAAAATTGATGATAATTTTGATATAAAGCTAATTCAGACGATTA
GAGGTAGTGGGTATTGTTTAAAAGAAACACAATTGTAA

Protein sequence :
MRILVVDDEPYLTDLLNKALKEEGYSVDIAQNGIDGMECAKMNVYDVIILDIMLPEIDGIQILKNLRNMNINTPILMLTA
KDALDDKVKGLDTGADDYMTKPFELSELTARIRALLRREQPSKSPILKIADLEVNTLTHDVRRGGKIITLTSKEYSLLEY
MMRNSGRVLTRSQIVDHVWGYEFDGLSNIIDVYIRYLRKKIDDNFDIKLIQTIRGSGYCLKETQL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-43 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-43 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0125 Protein 2e-50 51
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0308 Protein 1e-49 51
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0111 Protein 2e-49 49
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0083 Protein 3e-50 48
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0638 Protein 3e-44 48
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0347 Protein 6e-45 47
Tthe_1981 YP_003852548.1 transcriptional regulator BAC0197 Protein 3e-50 47
Tthe_1981 YP_003852548.1 transcriptional regulator NC_010079.5776364.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002952.2859858.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_007622.3794948.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_003923.1003417.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_013450.8614146.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002951.3238224.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_007793.3914065.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002758.1121390.p0 Protein 2e-40 45
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002952.2859905.p0 Protein 2e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_007793.3914279.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_007622.3794472.p0 Protein 2e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002745.1124361.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_009782.5559369.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002951.3237708.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_003923.1003749.p0 Protein 2e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_002758.1121668.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_009641.5332272.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator NC_013450.8614421.p0 Protein 1e-35 44
Tthe_1981 YP_003852548.1 transcriptional regulator AE015929.1.gene1106. Protein 1e-36 43
Tthe_1981 YP_003852548.1 transcriptional regulator AE016830.1.gene1681. Protein 7e-41 43
Tthe_1981 YP_003852548.1 transcriptional regulator HE999704.1.gene1528. Protein 1e-37 42
Tthe_1981 YP_003852548.1 transcriptional regulator NC_012469.1.7685629. Protein 6e-36 42
Tthe_1981 YP_003852548.1 transcriptional regulator HE999704.1.gene2815. Protein 9e-37 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tthe_1981 YP_003852548.1 transcriptional regulator VFG0596 Protein 4e-44 45
Tthe_1981 YP_003852548.1 transcriptional regulator VFG1390 Protein 4e-52 44
Tthe_1981 YP_003852548.1 transcriptional regulator VFG1386 Protein 3e-50 43