Gene Information

Name : ykoG (BSUW23_06795)
Accession : YP_003865716.1
Strain : Bacillus subtilis W23
Genome accession: NC_014479
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1352160 - 1352846 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
TTGGAAAAAGGGCACATATTAATCGTGGAAGATGAGGAAAAAATCGCCAGGGTGCTCCAGCTTGAATTGGAATATGAAGG
ATATAATGTCACCATTAAATACAATGGCACTGAAGGACTGAATGCGGCCGCGGAAGGCAGGTATTCCTTAGTGCTTCTAG
ACGTCATGCTTCCGGGACTTAGCGGCCTGGAAGTGCTGCGCCGCTTGAGAAAAACGGATCAGCAGACACCGGTCATTTTA
TTAACGGCACGCGACAGTATCCCTGATAAGGTAACAGGGCTGGACATCGGTGCGAATGACTACGTCACCAAGCCGTTTGA
AATTGAGGAATTGCTTGCGAGAATCAGGGTGGCGCTGCGCCAAAATGGAACAAAAACAGAAGATATCGACACCTTTCTTA
CATATGACGACTTGCGGGTGAACGAAAAAACCCGTGAAGTGAGGCGCGGAGACAAAGAGGTGGAATTAACGCCCCGGGAA
TTTGATTTGCTCGTCTATATGCTGAAACATCCGCAGCAAGTGCTGACACGGGAACAGATTCTAAACTCTGTATGGGGATT
TGATTATATCGGTGATACAAATGTGGTGGACGTTTACATCAGATACATCAGAAAAAAACTGGACTATCCTTACGAAAAAC
AGCTGATCCATACTGTTCGAGGGGTCGGCTATGCCATTAAGGGGTAA

Protein sequence :
MEKGHILIVEDEEKIARVLQLELEYEGYNVTIKYNGTEGLNAAAEGRYSLVLLDVMLPGLSGLEVLRRLRKTDQQTPVIL
LTARDSIPDKVTGLDIGANDYVTKPFEIEELLARIRVALRQNGTKTEDIDTFLTYDDLRVNEKTREVRRGDKEVELTPRE
FDLLVYMLKHPQQVLTREQILNSVWGFDYIGDTNVVDVYIRYIRKKLDYPYEKQLIHTVRGVGYAIKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-43 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-42 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_003865716.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-47 49
ykoG YP_003865716.1 two-component response regulator HE999704.1.gene1528. Protein 3e-44 48
ykoG YP_003865716.1 two-component response regulator BAC0125 Protein 2e-43 46
ykoG YP_003865716.1 two-component response regulator AE015929.1.gene1106. Protein 1e-39 45
ykoG YP_003865716.1 two-component response regulator BAC0308 Protein 1e-43 45
ykoG YP_003865716.1 two-component response regulator BAC0197 Protein 2e-40 44
ykoG YP_003865716.1 two-component response regulator BAC0083 Protein 2e-44 43
ykoG YP_003865716.1 two-component response regulator BAC0638 Protein 1e-36 42
ykoG YP_003865716.1 two-component response regulator AE016830.1.gene1681. Protein 4e-40 42
ykoG YP_003865716.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-34 41
ykoG YP_003865716.1 two-component response regulator NC_012469.1.7686381. Protein 1e-41 41
ykoG YP_003865716.1 two-component response regulator BAC0111 Protein 2e-40 41
ykoG YP_003865716.1 two-component response regulator BAC0347 Protein 8e-37 41
ykoG YP_003865716.1 two-component response regulator NC_012469.1.7685629. Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_003865716.1 two-component response regulator VFG0596 Protein 1e-43 45
ykoG YP_003865716.1 two-component response regulator VFG1386 Protein 4e-50 45
ykoG YP_003865716.1 two-component response regulator VFG1390 Protein 1e-49 44
ykoG YP_003865716.1 two-component response regulator VFG1389 Protein 2e-43 42