Gene Information

Name : PPE_02194 (PPE_02194)
Accession : YP_003870565.1
Strain : Paenibacillus polymyxa E681
Genome accession: NC_014483
Putative virulence/resistance : Virulence
Product : sensory transduction protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2394811 - 2395524 bp
Length : 714 bp
Strand : +
Note : COGMatches:COG0745; PfamMatches:PF00072, PF00486; PrositeMatches:PS50110, PS00217; go_process: regulation of transcription, DNA-dependent (GO:0006355)

DNA sequence :
ATGGAAAAGTCGGTGCTGGTCATTGACGATGAAAAGAAGATATCCAGATTGCTTCAGTTGGAGTTATCCCATGAAGGATA
TGCAGTTGAAATCGCACAGACGGGCAGAGAAGGATTGGAAAAAGCTCTAGCAGGTACATGGGATATCATCATACTGGATG
TAATGCTGCCGGAGATAAACGGGGTCGAGGTACTGAAGCAGATTCGAAAAGTGGATAATCATACACCAGTAATTATGGTC
ACTGCACGTAACACGACTCCTGACAAGGTTTCAGGTCTGGATGAAGGTGCCAACGATTACATTACGAAGCCTTTTGAGAT
CGAGGAGTTATTAGCGCGGATGCGGGCCAGTATGAGGCATCAAATGGAGCCAATAGCTACCGTTTTACAAGAAGAGGACA
AACCGCCGTCTAGGCTCCAAGTAGATAGTTTGGTGTTGGAACGCAAAACTAGGTTAGTGATGCGGGAAGGAAACCGAATC
GAACTGACGCCCAAAGAATTTGATCTGCTTCTTTATCTGATGGAGCACAAAAATCAGGTATTGCAGCGGGATCAAATGAT
TCAGGACGTGTGGGGATTTGATTTTGTCGGTGATACGAATGTCGTAGATGTGTATATCCGATATGTTCGCAAAAAAATTG
ATCATGGATACAAAAAGAAATTGATTAAAACCGTACGTGGTGTGGGGTACTGCATCAGGGAGGAAGAACATTGA

Protein sequence :
MEKSVLVIDDEKKISRLLQLELSHEGYAVEIAQTGREGLEKALAGTWDIIILDVMLPEINGVEVLKQIRKVDNHTPVIMV
TARNTTPDKVSGLDEGANDYITKPFEIEELLARMRASMRHQMEPIATVLQEEDKPPSRLQVDSLVLERKTRLVMREGNRI
ELTPKEFDLLLYLMEHKNQVLQRDQMIQDVWGFDFVGDTNVVDVYIRYVRKKIDHGYKKKLIKTVRGVGYCIREEEH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPE_02194 YP_003870565.1 sensory transduction protein HE999704.1.gene1528. Protein 3e-49 49
PPE_02194 YP_003870565.1 sensory transduction protein NC_007622.3794948.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_003923.1003417.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_013450.8614146.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_002951.3238224.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_007793.3914065.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_002758.1121390.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_010079.5776364.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein NC_002952.2859858.p0 Protein 4e-49 48
PPE_02194 YP_003870565.1 sensory transduction protein AE015929.1.gene1106. Protein 2e-46 47
PPE_02194 YP_003870565.1 sensory transduction protein BAC0125 Protein 4e-41 45
PPE_02194 YP_003870565.1 sensory transduction protein NC_012469.1.7685629. Protein 7e-42 43
PPE_02194 YP_003870565.1 sensory transduction protein NC_002952.2859905.p0 Protein 2e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_009782.5559369.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_002951.3237708.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_007622.3794472.p0 Protein 2e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_003923.1003749.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_002758.1121668.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_009641.5332272.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein AE016830.1.gene1681. Protein 2e-44 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_013450.8614421.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_007793.3914279.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein NC_002745.1124361.p0 Protein 1e-39 42
PPE_02194 YP_003870565.1 sensory transduction protein BAC0308 Protein 4e-39 41
PPE_02194 YP_003870565.1 sensory transduction protein FJ349556.1.orf0.gene Protein 5e-34 41
PPE_02194 YP_003870565.1 sensory transduction protein BAC0111 Protein 2e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPE_02194 YP_003870565.1 sensory transduction protein VFG0596 Protein 2e-41 41
PPE_02194 YP_003870565.1 sensory transduction protein VFG1390 Protein 2e-44 41
PPE_02194 YP_003870565.1 sensory transduction protein VFG1389 Protein 2e-39 41