Gene Information

Name : Cyan7822_1300 (Cyan7822_1300)
Accession : YP_003886577.1
Strain : Cyanothece sp. PCC 7822
Genome accession: NC_014501
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1413594 - 1414268 bp
Length : 675 bp
Strand : -
Note : KEGG: amr:AM1_1480 two-component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGCTGCTCATATCCTAGTTGTCGAAGATGAAGCTAAACTCGCTCAATTTATTGAATTAGAGCTTAAATATGAGGGTTA
TACTGTCACTGTTGCCCCAGATGGGTTAGCCGGGTTAACGGCGGCTAGAGAATCTCATCCCGATTTAATTTTATTGGATT
GGATGTTACCAGGAATTTCTGGGTTAGAAATTTGTAAGCGGCTGCGGCAAACCGGGGATAAAGTTCCGATTATTTTATTA
ACGGCTAAAGATGAAATTAGTGATCGCGTGACGGGTTTAGATGCCGGCGCAGATGATTATATTGTTAAACCCTTTAGTTT
AGAGGAATTACTGGCAAGAGTTCGGGCTAATTTACGACGTACACAAGAAGAAAACCCCGAGGAAATTTTATTTAATGATT
TACGACTTAACCGCAGTACCCGAGAAGTTTATCGCGCTAACCGTTTAATTGAATTGACGGCTAAAGAGTTTGAATTATTA
GAATATTTAATGTCTCATCCCCGCCAAGTTCTCACCCGTGACCAAATTTTAGAACGGGTATGGGGCTATGATTTCATGGG
AGATTCTAATATTATTGAGGTCTATGTCCGTTATTTACGCTTAAAACTCGAAGAGAATGGAGAGAAGCGGCTTATTCAAA
CTATTCGGGGTGTTGGGTATGTTTTACGAGATTAG

Protein sequence :
MAAHILVVEDEAKLAQFIELELKYEGYTVTVAPDGLAGLTAARESHPDLILLDWMLPGISGLEICKRLRQTGDKVPIILL
TAKDEISDRVTGLDAGADDYIVKPFSLEELLARVRANLRRTQEENPEEILFNDLRLNRSTREVYRANRLIELTAKEFELL
EYLMSHPRQVLTRDQILERVWGYDFMGDSNIIEVYVRYLRLKLEENGEKRLIQTIRGVGYVLRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-35 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 9e-45 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-48 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-45 49
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-41 48
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-46 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-46 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 47
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0111 Protein 6e-40 45
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-42 45
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-46 44
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 7e-38 44
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0347 Protein 5e-38 44
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-40 44
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-40 44
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-39 43
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-41 43
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-38 43
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 2e-35 43
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 8e-32 42
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 6e-29 42
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-33 42
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 6e-26 41
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 8e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-57 55
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-49 46
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-43 45
Cyan7822_1300 YP_003886577.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-35 44