Gene Information

Name : Cyan7822_4949 (Cyan7822_4949)
Accession : YP_003890115.1
Strain : Cyanothece sp. PCC 7822
Genome accession: NC_014501
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5386227 - 5386904 bp
Length : 678 bp
Strand : -
Note : KEGG: kol:Kole_0551 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCGGATACTCTTAGTCGAGGATGAACCAGGGATTGCTCAATTTATCAGTCAAGGGTTAAAAGAAACAGGCTATGTGGT
AGATATCGCCCCTGACGGACAACAAGGCAAAAATTATGTTGATGCGGTGGAATATGACATCATTATCTTAGACATCATGC
TCCCCAAAATTGATGGCTTGAAATTATTAGGAGAGATTCGCGCGAAAAAAGTCTCTGTACCGATTTTACTGCTGACTGCG
CGAGATAGCGTAGAAGATCGGGTCAAAGGCTTAAATCAGGGGGCTGATGATTATATGGTTAAACCCTTCGCCTTTTCAGA
ATTACTCGCCCGTATCAGGGCTTTACAACGTCGCCCTCCCCTTCAATTCAATACAGTTTTGGCATTAGGAGACTTGACGA
TGGACCTTGTCACCCGAGAAGTGAAACGAGGCGACAAGCTCATTGATCTGAGTCCTTTAGAATTTAAACTTTTAGAATAC
TTATTACGTAATTGTAACCAGGTATTAACTCGGACTCAAATCGGTGAGCAGGTTTGGAACCTGGATTTTTATAGCAATTC
TAATGTAGTTGATGTCTATGTGGGCTATCTCAGGCGCAAAATAGACCGAGGGTTTCAACGGCCTCTGTTACATACAGTGC
GAGGCGTAGGCTATTGTATGAAGGCAGAAGGCAGCTAA

Protein sequence :
MRILLVEDEPGIAQFISQGLKETGYVVDIAPDGQQGKNYVDAVEYDIIILDIMLPKIDGLKLLGEIRAKKVSVPILLLTA
RDSVEDRVKGLNQGADDYMVKPFAFSELLARIRALQRRPPLQFNTVLALGDLTMDLVTREVKRGDKLIDLSPLEFKLLEY
LLRNCNQVLTRTQIGEQVWNLDFYSNSNVVDVYVGYLRRKIDRGFQRPLLHTVRGVGYCMKAEGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-43 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-43 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0125 Protein 7e-49 49
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0638 Protein 8e-43 49
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-49 48
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-46 48
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-50 48
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-47 47
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-43 47
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-32 44
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-30 43
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-29 41
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator BAC0288 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-44 48
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-47 47
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-39 42
Cyan7822_4949 YP_003890115.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-37 42