Gene Information

Name : Thet_1763 (Thet_1763)
Accession : YP_003904630.1
Strain : Thermoanaerobacter sp. X513
Genome accession: NC_014538
Putative virulence/resistance : Resistance
Product : copper ion-binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1723601 - 1723825 bp
Length : 225 bp
Strand : -
Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGGGCCTGTTTGGAACTAAAGGTGAGACTATCGTTATAAATGTTAAAGGAATGTCATGCAATCATTGCAAAATGTCTGT
CGAAACTGCACTAAAGAAATTAAATGGGGTATCGAAAGCTATTGTTGACCCTGACAAAGGTAATGTTACGGTAACATATG
ATCCTGCTAAAGTTTCTGTAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA

Protein sequence :
MGLFGTKGETIVINVKGMSCNHCKMSVETALKKLNGVSKAIVDPDKGNVTVTYDPAKVSVDDMKKAIIDTGYEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-09 44
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 9e-09 44
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-09 43
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-09 43
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-09 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 9e-09 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-09 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-09 43
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-08 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thet_1763 YP_003904630.1 copper ion-binding protein BAC0634 Protein 2e-06 43
Thet_1763 YP_003904630.1 copper ion-binding protein BAC0679 Protein 6e-08 41