
|
Name : Thet_1763 (Thet_1763) Accession : YP_003904630.1 Strain : Thermoanaerobacter sp. X513 Genome accession: NC_014538 Putative virulence/resistance : Resistance Product : copper ion-binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1723601 - 1723825 bp Length : 225 bp Strand : - Note : KEGG: tte:TTE2466 copper chaperone; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGGGCCTGTTTGGAACTAAAGGTGAGACTATCGTTATAAATGTTAAAGGAATGTCATGCAATCATTGCAAAATGTCTGT CGAAACTGCACTAAAGAAATTAAATGGGGTATCGAAAGCTATTGTTGACCCTGACAAAGGTAATGTTACGGTAACATATG ATCCTGCTAAAGTTTCTGTAGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA Protein sequence : MGLFGTKGETIVINVKGMSCNHCKMSVETALKKLNGVSKAIVDPDKGNVTVTYDPAKVSVDDMKKAIIDTGYEV |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 6e-09 | 44 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 9e-09 | 44 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 7e-09 | 43 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 7e-09 | 43 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 7e-09 | 43 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 7e-09 | 43 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 9e-09 | 43 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 7e-09 | 43 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-08 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Thet_1763 | YP_003904630.1 | copper ion-binding protein | BAC0634 | Protein | 2e-06 | 43 |
| Thet_1763 | YP_003904630.1 | copper ion-binding protein | BAC0679 | Protein | 6e-08 | 41 |