Gene Information

Name : Fbal_2799 (Fbal_2799)
Accession : YP_003914075.1
Strain : Ferrimonas balearica DSM 9799
Genome accession: NC_014541
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3141611 - 3142300 bp
Length : 690 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867: IPR011879; KEGG: sfr:Sfri_2768 two component transcriptional regulator, winged helix family protein; PFAM: re

DNA sequence :
ATGACTGCCAATATCCTGATTGTTGAAGACGAATCCGCCATCCGTGAAATGCTGACCTTTGTGTTGGATCAGCACGGGTT
TCGTACCACCAGTGCCGCGGATTATGACCAGGGCCTGAACGCCATCAGCGAACCCTATCCCGACCTGGTCCTGCTGGATT
GGATGCTGCCTGGTGGCAGTGGTATCCAGTTGGCCAAAGCGCTGCGTCAGGATGAGCATACCCGCCAGATCCCCATCATC
ATGCTCACCGCCCGTGGCGAGGAAGAGGACCGTGTGCGCGGCCTTGAAGTGGGCGCGGACGACTACATCACCAAGCCGTT
CTCTCCCAAAGAGCTGGTGGCCCGCATCAAAGCGGTGCTGCGTCGCTCCGCCCCGACCCGCCTCGAAGAGGCCGTTGAGG
TGCAGGGCCTGCGCCTGGACCCGGTTTCCCACCGCGTCACCGTTGAGGAACAGGGGCTGGATATGGGGCCGACCGAGTTC
CGTCTGCTGCACTTCTTTATGACCCACCCTGAGCGGGTCTACAGCCGCGAGCAGCTGCTCGACAACGTGTGGGGCACCAA
CGTGTACGTTGAGGACCGCACCGTGGACGTGCACATCCGTCGCCTGCGCAAGGCGATTCAGGAAACCGGCCATGACAAAC
TGATCCAGACCGTGCGGGGCGCCGGTTATCGGTTCTCCACCAAGGTTTGA

Protein sequence :
MTANILIVEDESAIREMLTFVLDQHGFRTTSAADYDQGLNAISEPYPDLVLLDWMLPGGSGIQLAKALRQDEHTRQIPII
MLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVLRRSAPTRLEEAVEVQGLRLDPVSHRVTVEEQGLDMGPTEF
RLLHFFMTHPERVYSREQLLDNVWGTNVYVEDRTVDVHIRRLRKAIQETGHDKLIQTVRGAGYRFSTKV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-29 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-42 46
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-36 44
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 1e-34 43
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-26 43
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-31 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 4e-36 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 4e-36 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 1e-36 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-33 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 5e-36 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 1e-35 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 7e-36 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family BAC0596 Protein 5e-36 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family BAC0039 Protein 1e-35 42
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 2e-28 41
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 5e-29 41
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family BAC0533 Protein 2e-28 41
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-40 41
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family VFG0596 Protein 6e-30 41
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family VFG1563 Protein 5e-34 41
Fbal_2799 YP_003914075.1 two component transcriptional regulator, winged helix family VFG1702 Protein 5e-34 41