Gene Information

Name : AARI_17800 (AARI_17800)
Accession : YP_003916965.1
Strain : Arthrobacter arilaitensis Re117
Genome accession: NC_014550
Putative virulence/resistance : Unknown
Product : cold shock protein
Function : -
COG functional category : K : Transcription
COG ID : COG1278
EC number : -
Position : 2015035 - 2015238 bp
Length : 204 bp
Strand : +
Note : match to PF00313: cold-shock DNA-binding domain. The so-called cold shock proteins are thought to help the cell to survive in temperatures lower than optimum growth temperature, by contrast with heat shock proteins, which help the cell to survive in tempe

DNA sequence :
ATGGCCACTGGCACCGTGAAATGGTTCAACGCTGAAAAGGGCTTCGGCTTCATCGCTCCTTCGGATGGATCGGCTGACGT
CTTCGCACACTACAGCGCAATCCAGAGCTTCGGTTTCCGTAGCCTCGAAGAGGGCCAGACCGTTGAGTACACCCTGGAAG
CTGGTCCAAAGGGCCCACAGGCTACCAACATTCAGGCTCGCTAA

Protein sequence :
MATGTVKWFNAEKGFGFIAPSDGSADVFAHYSAIQSFGFRSLEEGQTVEYTLEAGPKGPQATNIQAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAO18076.1 unknown Not tested TTSS locus Protein 4e-17 67