
|
Name : AARI_17800 (AARI_17800) Accession : YP_003916965.1 Strain : Arthrobacter arilaitensis Re117 Genome accession: NC_014550 Putative virulence/resistance : Unknown Product : cold shock protein Function : - COG functional category : K : Transcription COG ID : COG1278 EC number : - Position : 2015035 - 2015238 bp Length : 204 bp Strand : + Note : match to PF00313: cold-shock DNA-binding domain. The so-called cold shock proteins are thought to help the cell to survive in temperatures lower than optimum growth temperature, by contrast with heat shock proteins, which help the cell to survive in tempe DNA sequence : ATGGCCACTGGCACCGTGAAATGGTTCAACGCTGAAAAGGGCTTCGGCTTCATCGCTCCTTCGGATGGATCGGCTGACGT CTTCGCACACTACAGCGCAATCCAGAGCTTCGGTTTCCGTAGCCTCGAAGAGGGCCAGACCGTTGAGTACACCCTGGAAG CTGGTCCAAAGGGCCCACAGGCTACCAACATTCAGGCTCGCTAA Protein sequence : MATGTVKWFNAEKGFGFIAPSDGSADVFAHYSAIQSFGFRSLEEGQTVEYTLEAGPKGPQATNIQAR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | AAO18076.1 | unknown | Not tested | TTSS locus | Protein | 4e-17 | 67 |