Gene Information

Name : AARI_02110 (AARI_02110)
Accession : YP_003915418.1
Strain : Arthrobacter arilaitensis Re117
Genome accession: NC_014550
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 216424 - 217092 bp
Length : 669 bp
Strand : -
Note : response regulators are key elements in two- component signal transduction systems, which enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions

DNA sequence :
ATGAGCCAGATCCTGATCATTGAAGATGAACCCCGCATCAGCTCATTCGTGGCCAAGGGGCTGCGCGCTGCGGGACTGAC
CTCATCCATCGCGGAAACCGGCCAAGATGGCTTCAATCTGGCGATCGAAGGCGATCATGAACTGATCATTTTGGATCTCG
GCCTGCCCGATGAAGATGGCTTCTCGGTGCTCCGCCGGCTGCGAGTAGCCCAGATCGACACTCCGGTGATCATCCTGACC
GCACGCGGCAGTGTCGAAGACACCGTGGCGGGCCTGCAGAATGGCGCGGATGACTACATGGCCAAGCCCTTCCACTTCGA
TGAGCTGCTGGCTCGCGTCCGCTTGAGGCTGCGCACCGAAGACAATGCCCCTGAAGTGTCTTCACTGACCCATGAGAACC
TGCATATGGATCTGCTGCGCCGCCGGGTCACGGTCAACGAACGCGAAGTGGACCTGTCGGCGCGCGAATTCGCGCTGGCT
GAAGCCTTCTTGCGCAATCCTGGCCAGGTGCTCAGCCGCGAGCAGCTGCTCTCCCGCGTGTGGGGCTACGACTTCGACCC
GGGATCCAATGTGGTGGATGTGTACGTGCGCTACCTGCGAAACAAGCTGGGCTCGGAACGCTTCGAAACCGTCCGCGGCT
TCGGCTACCGGCTTGCTTCCGAACGGTAG

Protein sequence :
MSQILIIEDEPRISSFVAKGLRAAGLTSSIAETGQDGFNLAIEGDHELIILDLGLPDEDGFSVLRRLRVAQIDTPVIILT
ARGSVEDTVAGLQNGADDYMAKPFHFDELLARVRLRLRTEDNAPEVSSLTHENLHMDLLRRRVTVNEREVDLSAREFALA
EAFLRNPGQVLSREQLLSRVWGYDFDPGSNVVDVYVRYLRNKLGSERFETVRGFGYRLASER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-37 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AARI_02110 YP_003915418.1 two-component system response regulator BAC0197 Protein 7e-37 45
AARI_02110 YP_003915418.1 two-component system response regulator BAC0125 Protein 6e-40 44
AARI_02110 YP_003915418.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-36 43
AARI_02110 YP_003915418.1 two-component system response regulator BAC0083 Protein 3e-41 43
AARI_02110 YP_003915418.1 two-component system response regulator BAC0111 Protein 1e-42 43
AARI_02110 YP_003915418.1 two-component system response regulator BAC0638 Protein 3e-35 43
AARI_02110 YP_003915418.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-32 42
AARI_02110 YP_003915418.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-34 42
AARI_02110 YP_003915418.1 two-component system response regulator BAC0308 Protein 4e-35 41
AARI_02110 YP_003915418.1 two-component system response regulator BAC0347 Protein 3e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AARI_02110 YP_003915418.1 two-component system response regulator VFG0596 Protein 5e-39 46
AARI_02110 YP_003915418.1 two-component system response regulator VFG1389 Protein 8e-37 45