Gene Information

Name : soxS (Pvag_3538)
Accession : YP_003933106.1
Strain : Pantoea vagans C9-1
Genome accession: NC_014562
Putative virulence/resistance : Resistance
Product : transcriptional activator of superoxide response regulon soxS
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 3756521 - 3756946 bp
Length : 426 bp
Strand : -
Note : AraC-type DNA-binding domain-containing proteins

DNA sequence :
ATGATGCAAGAAGAGATCATTCATTCCCTGACGGACTGGATTGACCAGAACCTCGATAAGAGCCTGTCGATTGATGAGGT
TGCGGCAAAATCAGGCTATTCGAAATGGCACCTGCAGCGTATGTTCCGTTCCGTGACGAAACAGACGCTGGGTGGCTATA
TTCGTGAGCGCCGCCTGACGCTGGCCGCAGAAGCGCTATCGCAGACACAGCGTCCGGTGTTTGATATCGCGATGCAATAT
GGCTATGACTCGCAGCAGACCTTCTCCAGGGTGTTTCGTCGTCAGTTTTCACAGACCCCGACCGCTTACCGCCACACCAT
GCGCCGCCAGGCGATTCAGCGCCCTCGCCTGCTGAGTTTTGGCTGTAACGACGGCATTACCAGCTTTACCCAGCGCACCA
CCGGCGAGTGCTGCCCGGTCCGTTAA

Protein sequence :
MMQEEIIHSLTDWIDQNLDKSLSIDEVAAKSGYSKWHLQRMFRSVTKQTLGGYIRERRLTLAAEALSQTQRPVFDIAMQY
GYDSQQTFSRVFRRQFSQTPTAYRHTMRRQAIQRPRLLSFGCNDGITSFTQRTTGECCPVR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-33 65
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-22 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-22 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS CP000647.1.gene4499. Protein 1e-34 67
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS BAC0371 Protein 2e-33 66
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS NC_002695.1.914293.p Protein 2e-33 66
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS CP001918.1.gene327.p Protein 2e-34 66
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS CP001138.1.gene4488. Protein 6e-34 65
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS CP000034.1.gene4505. Protein 4e-33 65
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS CP001138.1.gene612.p Protein 2e-26 50
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS NC_010558.1.6276025. Protein 9e-23 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS VFG0585 Protein 5e-34 65
soxS YP_003933106.1 transcriptional activator of superoxide response regulon soxS VFG1038 Protein 8e-23 48