Gene Information

Name : yedW (CLOST_2262)
Accession : YP_003937284.1
Strain : Clostridium sticklandii DSM 519
Genome accession: NC_014614
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component system with YedV
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2375589 - 2376284 bp
Length : 696 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type r : regulator

DNA sequence :
TTGCCTGATAAGAAAATACTAATCATTGAGGACGAATACAATATAGCGAGATTTTTGCAGCTAGAGCTAGAGCATGAGGG
TTATGAAGTGGGGATTTCACACGATGGAAGAGAAGGCTTGGACAAAGCGTGCAGCGATTATTTTGACTTGCTGATTTTAG
ATGTAATGCTACCTTCTTTGAATGGAGTTGAAGTACTTCGAAGACTCAGGCAAAAATCGGATATGCCTGTAGTCATGCTA
ACTGCAAAGGATGAAATGAATGATAAAATTTTAGGCCTTGATATTGGGGCTGATGATTATATGACAAAGCCATTTGCAAT
TGAAGAGCTTTTAGCAAGAATAAGAGTTATATTTAAAAGAATGGACAATTACAAAGCTAGCAAACCTCAAAATGATTCTA
TATTAAGAATTAAAGGGGTTAATCTAGACATCGACAGATATACTGTAACCTATAAAGAAAAAAATATTGATTTGACTAAA
AGAGAATTTGAGCTTTTAAAATATATGATGCAAAATAAAAATCTGGTAATTACAAGAGAAATGATTTTAGCCAAAGTGTG
GGGATACGAGTATATGGGAGATACAAATGTAGTGGATGTATATATTCGATATCTACGAAGTAAAATTGACGACCAATTTG
GAATCAAGTTAATCCATACTATTAGAGGAGTTGGATATCAAATAAAAGATGAATAA

Protein sequence :
MPDKKILIIEDEYNIARFLQLELEHEGYEVGISHDGREGLDKACSDYFDLLILDVMLPSLNGVEVLRRLRQKSDMPVVML
TAKDEMNDKILGLDIGADDYMTKPFAIEELLARIRVIFKRMDNYKASKPQNDSILRIKGVNLDIDRYTVTYKEKNIDLTK
REFELLKYMMQNKNLVITREMILAKVWGYEYMGDTNVVDVYIRYLRSKIDDQFGIKLIHTIRGVGYQIKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_003923.1003417.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_013450.8614146.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002951.3238224.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_007793.3914065.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002758.1121390.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_010079.5776364.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002952.2859858.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_007622.3794948.p0 Protein 6e-51 53
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV AE015929.1.gene1106. Protein 5e-45 51
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV HE999704.1.gene1528. Protein 3e-46 51
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV BAC0308 Protein 8e-44 44
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV BAC0125 Protein 2e-41 44
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV AE016830.1.gene1681. Protein 3e-45 44
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV BAC0083 Protein 2e-43 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV AF155139.2.orf0.gene Protein 3e-36 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002952.2859905.p0 Protein 8e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002745.1124361.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_009782.5559369.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002951.3237708.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_007622.3794472.p0 Protein 8e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_003923.1003749.p0 Protein 5e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_002758.1121668.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_009641.5332272.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_013450.8614421.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_007793.3914279.p0 Protein 6e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV BAC0197 Protein 8e-42 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV HE999704.1.gene2815. Protein 2e-41 43
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV NC_012469.1.7685629. Protein 4e-38 42
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV FJ349556.1.orf0.gene Protein 1e-31 41
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV BAC0638 Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV VFG1386 Protein 1e-43 42
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV VFG0596 Protein 5e-41 41
yedW YP_003937284.1 DNA-binding response regulator in two-component system with YedV VFG1390 Protein 5e-44 41