Name : Entcl_1385 (Entcl_1385) Accession : YP_003940932.1 Strain : Enterobacter cloacae SCF1 Genome accession: NC_014618 Putative virulence/resistance : Unknown Product : transposase IS3/IS911 family protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 1461635 - 1461937 bp Length : 303 bp Strand : + Note : PFAM: transposase IS3/IS911 family protein; KEGG: epy:EpC_28130 transposase, probable fragment DNA sequence : ATGAAACGAAGAAATTTTAGTCCTGAATTCAAACGCGAATCCGCTCAGCTGGTTGTTGATCAAAACTACACCGTCTCTGA TGCCGCTAAGGCTATGAATGTCGGTCTTTCCACGATGACAAAATGGGTCAAGCAACTGCGTGAAGAGCGTCAGGGAAAAA CACCAAAAGCCTCTCCGATAACACCGGAACAAATCGAAATACGTGAACTGAAGAAAAAGCTACAACGTATTGAAATAGAA AACGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA Protein sequence : MKRRNFSPEFKRESAQLVVDQNYTVSDAAKAMNVGLSTMTKWVKQLREERQGKTPKASPITPEQIEIRELKKKLQRIEIE NEILKKATALLMSDSLNSSR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 1e-39 | 91 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 1e-39 | 91 |
api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 8e-34 | 90 |
insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 2e-38 | 88 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-32 | 82 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 4e-32 | 82 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 4e-32 | 82 |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-32 | 82 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 3e-32 | 82 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-32 | 82 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-32 | 82 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 3e-32 | 82 |
unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 9e-29 | 70 |
aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 1e-25 | 63 |
ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 2e-25 | 63 |
unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 5e-24 | 61 |
unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 4e-24 | 61 |
Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 6e-24 | 61 |
ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 6e-24 | 61 |
RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 9e-23 | 57 |
trp1329A | CAB46577.1 | IS1329 transposase A | Not tested | HPI | Protein | 2e-20 | 47 |
tnpA | CAB61575.1 | transposase A | Not tested | HPI | Protein | 8e-20 | 46 |
unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-12 | 43 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Entcl_1385 | YP_003940932.1 | transposase IS3/IS911 family protein | VFG1485 | Protein | 6e-40 | 91 |
Entcl_1385 | YP_003940932.1 | transposase IS3/IS911 family protein | VFG1123 | Protein | 1e-32 | 82 |
Entcl_1385 | YP_003940932.1 | transposase IS3/IS911 family protein | VFG1553 | Protein | 4e-29 | 70 |
Entcl_1385 | YP_003940932.1 | transposase IS3/IS911 family protein | VFG0784 | Protein | 2e-24 | 61 |
Entcl_1385 | YP_003940932.1 | transposase IS3/IS911 family protein | VFG1566 | Protein | 5e-13 | 43 |