Gene Information

Name : PPSC2_c1003 (PPSC2_c1003)
Accession : YP_003945226.1
Strain : Paenibacillus polymyxa SC2
Genome accession: NC_014622
Putative virulence/resistance : Resistance
Product : tellurium resistance protein, terd family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1135189 - 1135764 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGCAATTAACTTATCTAAAGGTCAAAAAATTGATTTGACGAAAACAAACCCAGGTTTGTCCAAAATTATGGTTGGTCT
CGGCTGGGACACCAATAAGTACGATGGTGGTAAGGATTTTGACTTGGACGTATCCGTATTTCTGGCGAATGCGGACGGCA
AAGTAGAAACGGAAAAGAACTTCGTTTTCTTTAATAATCCACAAAACGAGAACGGTTCTGTCGTTCATACCGGAGATAAC
CGCACAGGTGAAGGTGACGGAGATGACGAGCAAATTAAAGTTGATCTGAGCAATGTACCTGCTAACGTAGAAAAGATCGC
TTTTACGATTACGATCTATGATGCACAAGAACGCAGCCAAAACTTTGGACAAGTGTCCCGTGCTTATGCGCGTATTGTAA
ATGAAGCAAACAACGAAGAATTGGTTCGCTTTGATTTGGGAGAAGATTTCTCGATCGAAACAGGCGTTGTGGTAGGCGAG
CTGTATCGCCATAGCGGTGAGTGGAAGTTCAATGCCATTGGTAGCGGCTACCAGGATGGTCTTGCAGGGTTGACACGCGA
TTACGGCTTAGCTTAA

Protein sequence :
MAINLSKGQKIDLTKTNPGLSKIMVGLGWDTNKYDGGKDFDLDVSVFLANADGKVETEKNFVFFNNPQNENGSVVHTGDN
RTGEGDGDDEQIKVDLSNVPANVEKIAFTITIYDAQERSQNFGQVSRAYARIVNEANNEELVRFDLGEDFSIETGVVVGE
LYRHSGEWKFNAIGSGYQDGLAGLTRDYGLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-54 59
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 55
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-52 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 53
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-49 53
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-49 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-47 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PPSC2_c1003 YP_003945226.1 tellurium resistance protein, terd family BAC0389 Protein 4e-52 55
PPSC2_c1003 YP_003945226.1 tellurium resistance protein, terd family BAC0390 Protein 2e-51 53