Gene Information

Name : STAUR_7042 (STAUR_7042)
Accession : YP_003956625.1
Strain : Stigmatella aurantiaca DW4/3-1
Genome accession: NC_014623
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 8617938 - 8618663 bp
Length : 726 bp
Strand : +
Note : -

DNA sequence :
ATGGAGCGCCCCACGGGCGACGACACCACCGCCACCATTCAAGTCCTGCTGGTCGAGGATGACGAGCGCCTGGCCCGGCT
CACCAGCCGCTATCTCCAGGAACATGGCCTCATCGTCACCATCGCCCGGACAGGCCCCGAGGGGCTCGCCGAGGCGGGCC
GCCACGCCTACGACGTCCTCCTGCTCGACCTGATGCTGCCCGGCCGGGACGGGCTGGAGGTGTGCCGCGAGCTGCGCACG
CGCAGCGATGTGCCCATCATCATGGTCACCGCCCGGGGCGAGGAGATCGACCGGGTGCTCGGGCTGGAGACGGGCGCTGA
CGACTACCTCCCCAAACCGTACTCCTCGCGGGAGCTGCTCGCGCGCATCCGGGCGCAGGTGCGGCGGGCCCGGGGCAACG
CCGGGCCCTCGCTCCAGCCGCTCAACGTGGGCCGGCTCCAGATGGACCCGCGCAGCCTCACCGCGGTGCTCAATGGCAAG
ACCCTGTCGCTCACCAGCTACGAGTTCAACCTCCTGCGCGTCCTGGCCGAGCGGGCCGGGCGCGTGCTCAGCCGCGAGCA
GCTCCTGGACCTCATCAAGGGCAGCGCGGACGAGGTGTTCGACCGCTCCATCGACGTCCACATCTTCCGCTTGAGACAGA
AGCTGGAGGAGGATCCGCGCAACCCGCGGATGCTCAAGACGGTGCGGGGGGCGGGCTACCTGCTCGCCCGGGGAGATGAA
CCGTGA

Protein sequence :
MERPTGDDTTATIQVLLVEDDERLARLTSRYLQEHGLIVTIARTGPEGLAEAGRHAYDVLLLDLMLPGRDGLEVCRELRT
RSDVPIIMVTARGEEIDRVLGLETGADDYLPKPYSSRELLARIRAQVRRARGNAGPSLQPLNVGRLQMDPRSLTAVLNGK
TLSLTSYEFNLLRVLAERAGRVLSREQLLDLIKGSADEVFDRSIDVHIFRLRQKLEEDPRNPRMLKTVRGAGYLLARGDE
P

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-31 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 4e-33 47
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 4e-45 45
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator BAC0533 Protein 1e-34 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 1e-34 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-38 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-37 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-38 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-37 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-37 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-37 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-37 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-37 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 4e-39 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 3e-34 43
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-34 43
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-34 43
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-41 43
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-32 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-35 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-35 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-35 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-35 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-38 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-39 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-40 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-27 44
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-31 42
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-33 41
STAUR_7042 YP_003956625.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-33 41