Gene Information

Name : BATR1942_06455 (BATR1942_06455)
Accession : YP_003973176.1
Strain : Bacillus atrophaeus 1942
Genome accession: NC_014639
Putative virulence/resistance : Resistance
Product : small multidrug resistance efflux transporter
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1326182 - 1326496 bp
Length : 315 bp
Strand : -
Note : COG2076 Membrane transporters of cations and cationic drugs

DNA sequence :
ATGATATTAGGTTACACCTTCCTCGCAATTGCTATATTATCAGAATCAATGGGCGCTGCCATGCTGAAAGTCTCTCATGG
CTTCACCCGCTGGAAGCCGATCATGTTCGTCATCATCGGGTATTCACTTGCCTTTTATATGCTGTCGCTGACATTAAACC
ATATACCTCTCGGCTTATCATATGCCACTTGGAGCGGAGCGGGCACGGTGCTGACAGCGGTTATCGGAGCAAAGTGGTTT
GAAGAGAAGCTGAATAAACAAGGAATTGCCGGGATTCTGTTATTAATATCGGGAGTTGTGTTATTAAATTGGTAA

Protein sequence :
MILGYTFLAIAILSESMGAAMLKVSHGFTRWKPIMFVIIGYSLAFYMLSLTLNHIPLGLSYATWSGAGTVLTAVIGAKWF
EEKLNKQGIAGILLLISGVVLLNW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 48
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 2e-11 48
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 1e-11 48
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 48
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 2e-11 48
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 1e-11 48
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 1e-11 48
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 48
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 48
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 1e-11 48
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 1e-11 48
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 1e-11 48
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 1e-11 48
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 2e-11 48
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 1e-11 48
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 48
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-11 48
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 1e-11 48
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 1e-11 48
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 2e-11 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0139 Protein 9e-27 76
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0322 Protein 1e-12 49
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0323 Protein 5e-12 48
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter NC_010410.6003348.p0 Protein 4e-15 46
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0002 Protein 4e-15 46
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0321 Protein 1e-14 45
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0329 Protein 3e-13 45
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter CP001138.1.gene1489. Protein 1e-09 45
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0325 Protein 2e-11 42
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter CP004022.1.gene1549. Protein 9e-12 42
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0377 Protein 2e-12 42
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter NC_002695.1.913273.p Protein 2e-10 42
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0150 Protein 2e-10 42
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0327 Protein 1e-12 41
BATR1942_06455 YP_003973176.1 small multidrug resistance efflux transporter BAC0326 Protein 1e-12 41