Gene Information

Name : Halsa_1753 (Halsa_1753)
Accession : YP_003995526.1
Strain : Halanaerobium hydrogeniformans sapolanicus
Genome accession: NC_014654
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1954517 - 1955206 bp
Length : 690 bp
Strand : -
Note : KEGG: tte:TTE1016 response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
GTGAGTAAAAAAATACTAATTATTGAAGATGATGCTCAGATAGCTCGTTTTGTTGAATTAGAGTTAGAACATGAGGGTTA
TCAAGTTAAAAAATTTGATAACGGTTATGATGGGATTAATGCTCTTAAAGAAGATGATTATGACCTTTTATTACTAGACC
TTATGCTCCCAGGTTTAGATGGAATAGAAGTTTGCAATAAAATAAGAGAATTTTCTGATCTGCCAATAATAATGCTCACT
GCAAAATCTGAATTAGAAGATAAGGTAGCAGGTTTGGATACTGGAGCGGATGATTATTTAACTAAACCATTTGAAATAGA
AGAATTATTAGCAAGAATTAGGGCATTATTAAGAAGAGATAAAGGCACTATAGAATCTGCCAATATTTTAAATATTTCTG
ACATAGAAGTAAACCTTGATGCTCACCAGGTAAAAAGAGCTGGCCAAAAAATTGAACTAACTAAAAAAGAGTATGATCTT
TTAGTTTATTTAATTAAAAATGAAGGAATAGTTGTTAGTAGAGATAAGTTATTAAATAATGTTTGGGGATATAATTATAC
CGGTGAGACTAATATAGTAGATGTATATATTCGGTATTTAAGAAGTAAAATTGATGAGCCATTTGAAGAAAAATTAATAC
ATACAGTACGTGGAGTTGGTTATGTGATGAGGTCTGATCAAGATGATTAA

Protein sequence :
MSKKILIIEDDAQIARFVELELEHEGYQVKKFDNGYDGINALKEDDYDLLLLDLMLPGLDGIEVCNKIREFSDLPIIMLT
AKSELEDKVAGLDTGADDYLTKPFEIEELLARIRALLRRDKGTIESANILNISDIEVNLDAHQVKRAGQKIELTKKEYDL
LVYLIKNEGIVVSRDKLLNNVWGYNYTGETNIVDVYIRYLRSKIDEPFEEKLIHTVRGVGYVMRSDQDD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-31 55
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-35 54
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-41 52
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-31 48
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 7e-34 46
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-31 44
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-26 44
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-27 44
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 2e-25 43
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-30 43
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-27 43
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-26 42
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-28 42
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0111 Protein 8e-29 42
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-23 42
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-31 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-30 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 2e-22 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 6e-28 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 8e-24 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 8e-24 41
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-27 43
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family VFG1390 Protein 8e-34 43
Halsa_1753 YP_003995526.1 two component transcriptional regulator, winged helix family VFG1386 Protein 8e-33 41