Gene Information

Name : mtrA (REQ_33360)
Accession : YP_004008011.1
Strain : Rhodococcus equi 103S
Genome accession: NC_014659
Putative virulence/resistance : Virulence
Product : two component system response regulator mtra
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3547204 - 3547881 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGAAGCCAAGGATTCTGGTTGTCGACGATGACACGGCGCTCGCCGAGATGCTCACCATCGTGCTTCGTGGGGAGGGGTT
CGAACCCTACGTGGTGGGCGACGGCAGCCAGGCACTGACGGCCGTCCGTGAGACGCGTCCGGACCTGGTGCTGCTCGACC
TCATGCTTCCCGGCATGAACGGCATCGACGTCTGCCGTGTCCTGCGGGCCGAGTCCGGCGTGCCGATCGTGATGCTCACC
GCCAAGACGGACACCGTCGACGTGGTACTCGGGCTCGAGTCCGGGGCGGACGACTACATCATGAAGCCGTTCAAGCCCAA
GGAACTGGTCGCCCGAGTCCGCGCCCGGCTGCGTCGCACCGAGGAGGAGCCGGCAGAGGTGCTCAGCATCGGCGACATCA
TGATCGATGTCCCGGCGCACAAGGTCACCCGCGACAACGCGCTGATCTCGCTGACGCCCCTCGAGTTCGATCTCCTGGTG
GCGCTGGCCCGCAAGCCGCGTCAGGTCTTCACCCGCGAGGTGCTGCTCGAGCAGGTGTGGGGTTACCGCCACGCCGCCGA
CACCCGACTGGTGAACGTGCACGTGCAGCGGCTGCGCGCGAAGGTCGAGAAGGATCCTGAGAACCCGGAGGTGGTGCTCA
CAGTCAGGGGGGTCGGCTACAAGGCCGGACCGCCGTGA

Protein sequence :
MKPRILVVDDDTALAEMLTIVLRGEGFEPYVVGDGSQALTAVRETRPDLVLLDLMLPGMNGIDVCRVLRAESGVPIVMLT
AKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRRTEEEPAEVLSIGDIMIDVPAHKVTRDNALISLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKVEKDPENPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004008011.1 two component system response regulator mtra AE000516.2.gene3505. Protein 2e-89 89
mtrA YP_004008011.1 two component system response regulator mtra NC_002952.2859905.p0 Protein 9e-44 47
mtrA YP_004008011.1 two component system response regulator mtra NC_013450.8614421.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_007793.3914279.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_002745.1124361.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_009782.5559369.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_002951.3237708.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_003923.1003749.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_002758.1121668.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_007622.3794472.p0 Protein 7e-44 47
mtrA YP_004008011.1 two component system response regulator mtra NC_009641.5332272.p0 Protein 1e-43 47
mtrA YP_004008011.1 two component system response regulator mtra NC_012469.1.7686381. Protein 2e-39 44
mtrA YP_004008011.1 two component system response regulator mtra HE999704.1.gene2815. Protein 4e-39 44
mtrA YP_004008011.1 two component system response regulator mtra CP001918.1.gene3444. Protein 1e-37 44
mtrA YP_004008011.1 two component system response regulator mtra AE015929.1.gene1106. Protein 1e-29 43
mtrA YP_004008011.1 two component system response regulator mtra NC_012469.1.7685629. Protein 2e-36 43
mtrA YP_004008011.1 two component system response regulator mtra BAC0125 Protein 2e-30 43
mtrA YP_004008011.1 two component system response regulator mtra CP000647.1.gene2531. Protein 5e-36 42
mtrA YP_004008011.1 two component system response regulator mtra BAC0347 Protein 3e-22 41
mtrA YP_004008011.1 two component system response regulator mtra BAC0111 Protein 9e-27 41
mtrA YP_004008011.1 two component system response regulator mtra HE999704.1.gene1528. Protein 7e-35 41
mtrA YP_004008011.1 two component system response regulator mtra CP000675.2.gene1535. Protein 4e-30 41
mtrA YP_004008011.1 two component system response regulator mtra CP001485.1.gene721.p Protein 4e-27 41
mtrA YP_004008011.1 two component system response regulator mtra BAC0197 Protein 4e-27 41
mtrA YP_004008011.1 two component system response regulator mtra CP000034.1.gene3671. Protein 2e-31 41
mtrA YP_004008011.1 two component system response regulator mtra CP001138.1.gene2239. Protein 2e-35 41
mtrA YP_004008011.1 two component system response regulator mtra CP000034.1.gene2186. Protein 1e-36 41
mtrA YP_004008011.1 two component system response regulator mtra NC_002695.1.916589.p Protein 9e-37 41
mtrA YP_004008011.1 two component system response regulator mtra BAC0596 Protein 2e-35 41
mtrA YP_004008011.1 two component system response regulator mtra BAC0039 Protein 1e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004008011.1 two component system response regulator mtra VFG1390 Protein 2e-31 44
mtrA YP_004008011.1 two component system response regulator mtra VFG1389 Protein 1e-27 43
mtrA YP_004008011.1 two component system response regulator mtra VFG1702 Protein 2e-34 42
mtrA YP_004008011.1 two component system response regulator mtra VFG1563 Protein 4e-34 41