Gene Information

Name : Rvan_1441 (Rvan_1441)
Accession : YP_004011795.1
Strain : Rhodomicrobium vannielii ATCC 17100
Genome accession: NC_014664
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1588338 - 1588685 bp
Length : 348 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: xau:Xaut_5014 IS66 Orf2 family protein

DNA sequence :
ATGATCCCGGTTCCGACCGGCGTGCGGGTGTGGCTGGCGACGGGTCACACCGATATGCGCAGGGGCTTCCCGTCGCTGTC
CTTGCAGGTCCAGGAGGTTTTGCAGCGCGATCCTTTGAGCGGCCATCTGTTTTGCTTTCGCGGCCGCCGGGGCGATCTTC
TGAAGGTGATCTGGCATGACGGCCAGGGCGCCTGCCTTTTTACGAAGCGTCTGGAGAAAGGCCGGTTCTTGTGGCCGAGC
CCGGCTGACGGCGCGATCTCGATTTCGCCCGCGCAGCTTGGCTATCTGCTCTCCGGGATCGATTGGCGCAATCCGCAAAA
AACCTGGAGACCGACTTCGGTTGGCTGA

Protein sequence :
MIPVPTGVRVWLATGHTDMRRGFPSLSLQVQEVLQRDPLSGHLFCFRGRRGDLLKVIWHDGQGACLFTKRLEKGRFLWPS
PADGAISISPAQLGYLLSGIDWRNPQKTWRPTSVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-31 60
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-31 60
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-31 60
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-29 57
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-29 57
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-26 56
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-22 56
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-30 56
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-30 56
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-30 56
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-28 56
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-28 56
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-28 56
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 7e-28 56
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-28 56
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 7e-28 56
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-28 56
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-28 56
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-28 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-28 56
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-29 55
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-29 55
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-28 55
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-28 53
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-28 53

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG1665 Protein 5e-32 60
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG1698 Protein 1e-29 57
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG1517 Protein 9e-23 56
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG1737 Protein 1e-30 56
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG1709 Protein 4e-29 56
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG0792 Protein 4e-29 56
Rvan_1441 YP_004011795.1 IS66 Orf2 family protein VFG1052 Protein 8e-29 55