Gene Information

Name : Calkr_0253 (Calkr_0253)
Accession : YP_004025431.1
Strain : Caldicellulosiruptor kristjanssonii 177R1B
Genome accession: NC_014721
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 294203 - 294898 bp
Length : 696 bp
Strand : +
Note : KEGG: aoe:Clos_0943 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGCCATCATACAAGATTTTGATAATAGAAGATGAAAAACAAATAGCTCGATTTATTGAATTAGAATTAAAGCATGAAGG
CTACGATGTATATGTATGTTATGATGGCAAAGAAGGACTTAAAAAAGTTGAAGAGATACATCCAGATTTGATATTGTTGG
ATATTATGTTGCCGGGGATAAATGGCATTGAAATTTGCAGAAAAATAAGACAACATTCCAATGTCCCTATCATTATGGTT
ACAGCTAAGGATGATATTCCAGATAGAGTAATGGGCTTAGACAGTGGAGCGGATGACTATGTCACAAAACCATTTGCAAT
AGAAGAGTTGTTAGCAAGAATAAGAGCAGCTTTGAGAAAAAGCAAACAATTAAATATAATTCGTGAAATTCTCACTATTG
CTGATTTGACTATTGATACATCCAAACGGATTGTTAAAAGAGCTGATAAGATAATTGAGCTTACAAAAAGAGAATATGAT
TTGCTTGAATATTTAGTGAGAAACAAGGGAATTGTTTTAACCAGAGATCAAATTTTAGAAAATGTTTGGGGATATAGCTA
TATGGGCGATACGAATGTGGTGGATGTATATATCCGATATCTGCGCAGTAAAGTAGATGATGGTTTTAAAACAAAACTAA
TTCATACAGTAAGAGGAGTTGGGTATAAATGTGAGGAGAGAGAAAATGAAGATTAA

Protein sequence :
MPSYKILIIEDEKQIARFIELELKHEGYDVYVCYDGKEGLKKVEEIHPDLILLDIMLPGINGIEICRKIRQHSNVPIIMV
TAKDDIPDRVMGLDSGADDYVTKPFAIEELLARIRAALRKSKQLNIIREILTIADLTIDTSKRIVKRADKIIELTKREYD
LLEYLVRNKGIVLTRDQILENVWGYSYMGDTNVVDVYIRYLRSKVDDGFKTKLIHTVRGVGYKCEERENED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-42 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-41 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-52 57
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-46 56
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-49 55
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0125 Protein 1e-44 50
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-41 48
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-42 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-46 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-44 45
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-40 44
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0111 Protein 3e-41 43
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 5e-37 43
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-40 43
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0347 Protein 3e-37 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-44 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-34 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 5e-38 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-35 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-36 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 3e-39 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 3e-39 42
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 2e-36 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-42 46
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-48 44
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-42 43
Calkr_0253 YP_004025431.1 two component transcriptional regulator, winged helix family VFG1386 Protein 2e-45 41