Gene Information

Name : Ocepr_2200 (Ocepr_2200)
Accession : YP_004058822.1
Strain : Oceanithermus profundus DSM 14977
Genome accession: NC_014761
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2247290 - 2247997 bp
Length : 708 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: msv:Mesil_1100 two component transcriptional regulator, winged helix family; PFAM: response regulator r

DNA sequence :
GTGAACCCCGCACACCCCGAACCTACCCCCGAAGACCCTAAACGCATCCTGATCATCGAGGACGACCCCGAGATCGCCAG
CCTGCTCCAGGCCGAGCTGGGCGAGGCCGGCTACCGGGTGGACTGGGCGCCCGGGGGGATGCAGGGCCTCGTCAAGCTGC
GCGAAGATCCGCCCCACCTGATCGTCCTCGACCTGGGGCTGCCCGACCTCGACGGCTCCGAGATCGCACGGCGCGCCAAG
CAGCACGGCGACGTGCCCATCATCGTGCTCACGGCCACCGACGCGGTGGAGCGCAAGGTGCAGCTGCTGCTCGGCGGCGC
CGACGACTACCTGACCAAGCCCTTCCACCCCGCCGAGCTGCTGGCGCGCATCCAGGTGCAGCTGCGCCGCGGCGAGGGCG
GCGAGGTGCGGCGCGTCGGCGACCTGGAGATCGAGGTCGAGACGCGCCGGGTGCGCGCCGGCGGCCGCGAGGTGGCCCTC
TCGCCCAAGGAGTTCGCGCTGCTCGAGCTGCTCTCCAGCCGACCCGGCCGCGTCTTCAGCCGCGACGAGATCGCCCGCCA
CATCTGGGGCAAGCCGCTGGAGACCGAGTCGAACGTCGTGGACGTGCACGTCGCCAACCTGCGCGCCAAGCTGCGCGAGG
CGGGGGCCTACGGCTACCTGCGCACGGTCCGCGGCGTCGGCTACGCGCTGCGCAAGCCGGCGTCGTAG

Protein sequence :
MNPAHPEPTPEDPKRILIIEDDPEIASLLQAELGEAGYRVDWAPGGMQGLVKLREDPPHLIVLDLGLPDLDGSEIARRAK
QHGDVPIIVLTATDAVERKVQLLLGGADDYLTKPFHPAELLARIQVQLRRGEGGEVRRVGDLEIEVETRRVRAGGREVAL
SPKEFALLELLSSRPGRVFSRDEIARHIWGKPLETESNVVDVHVANLRAKLREAGAYGYLRTVRGVGYALRKPAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-32 43
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-32 42
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-32 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-31 41
Ocepr_2200 YP_004058822.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-32 41