Gene Information

Name : PSM_A2617 (PSM_A2617)
Accession : YP_004069682.1
Strain :
Genome accession: NC_014803
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2794299 - 2794622 bp
Length : 324 bp
Strand : -
Note : -

DNA sequence :
TTGGGTGAAAAAATGACGAAATTAAAACGCGCAACATACTCTGCGGCAATCAAATTAGAAACGGCTCAGCTTGTGGTGGA
CCAAGGTTATACACAAGAAGATGCAGCCAAGGCTATGGGGGTGGGTAAATCAACCGTCAGTAAATGGGTTACCCAATTAA
AGCAAGAGCGTAATGGTCAGTCACCATCTGCTTCGCCAATGACGCCCGAACAAATTGAAATCCGCGAACTTAAAAAGCAA
ATCCAACGCATTGAATTAGAAAAGGATATATTAAAAAAGGCTACCGCTCTCTTGATGTCCGACTCCCTGAACAATTCTCG
TTAA

Protein sequence :
MGEKMTKLKRATYSAAIKLETAQLVVDQGYTQEDAAKAMGVGKSTVSKWVTQLKQERNGQSPSASPMTPEQIEIRELKKQ
IQRIELEKDILKKATALLMSDSLNNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-28 68
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-29 67
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-29 67
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 67
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-29 67
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-29 67
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-29 67
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 67
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 67
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 67
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 67
api80 CAF28554.1 putative transposase Not tested YAPI Protein 9e-24 64
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-26 58
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 7e-23 55
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-23 55
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-23 55
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-23 55
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 9e-25 55
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-24 55
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-21 53

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSM_A2617 YP_004069682.1 transposase IS3/IS911 family protein VFG1485 Protein 2e-29 67
PSM_A2617 YP_004069682.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-29 67
PSM_A2617 YP_004069682.1 transposase IS3/IS911 family protein VFG1553 Protein 2e-26 58
PSM_A2617 YP_004069682.1 transposase IS3/IS911 family protein VFG0784 Protein 1e-23 55