Gene Information

Name : ML5_4229 (ML5_4229)
Accession : YP_004083882.1
Strain : Micromonospora sp. L5
Genome accession: NC_014815
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4482182 - 4482874 bp
Length : 693 bp
Strand : +
Note : KEGG: saq:Sare_3070 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGGTGTACGTGTGCTGGTGGTCGACGACGAGCGCAGCCTGGCCAAGGTCGTCGCCAGCTATCTGGAGCGCGACGGTCA
CGAGGTGAGCTGCGTCTTCGACGGCCGGTCGGCGGTCGCGGCCGCCCGGCGGGACCGGCCCGACGTGGTGGTGCTGGACC
TCGCCCTGCCGGGCCTGGACGGCATCGAGGTCTGCCGCCAGATCCGCACGTTCACCGACTGCTACGTGGTCATGCTCACC
GCCCGCAGCGAGGAGGTCGACAAGCTCATCGGCCTCGGCGTCGGCGCGGACGACTACCTGACCAAGCCGTTCAGCCCGCG
CGAACTCGTCGCCCGGATCCGCGCCATGCTGCGCCGTCCCCGCGCCGCCGTGGCCCCGGCCGCGGAGCAGTCGACCCGGA
CGGTCGGCGGGCTGCGGGTCGACCTGGCCGGCCGTGAGGTGTACGTCGACGAGCAGCCCGTGGAACTCACCCGGACGGAG
TTCGACCTGCTTGCCGCGTTGTCCGCGCAGCCGGACACGGCGCTGCGCCGCCGGCAGCTCATCGACGCGGTGTGGGGTGC
CGACTGGGTCGGCGACGAGCACCTCGTCGATGTGCACATCGCCCACCTGCGCCGCAAGCTCGGCGACGATCCCGCCGGGC
CCCGGTTCATCCGCACCGTCCGCGGCATCGGCTACCGGATGGGGCGGGGATGA

Protein sequence :
MGVRVLVVDDERSLAKVVASYLERDGHEVSCVFDGRSAVAAARRDRPDVVVLDLALPGLDGIEVCRQIRTFTDCYVVMLT
ARSEEVDKLIGLGVGADDYLTKPFSPRELVARIRAMLRRPRAAVAPAAEQSTRTVGGLRVDLAGREVYVDEQPVELTRTE
FDLLAALSAQPDTALRRRQLIDAVWGADWVGDEHLVDVHIAHLRRKLGDDPAGPRFIRTVRGIGYRMGRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-21 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-31 44
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-34 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-28 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-24 43
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-28 41
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-22 42
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-22 42
ML5_4229 YP_004083882.1 winged helix family two component transcriptional regulator VFG1563 Protein 8e-23 41