Gene Information

Name : ML5_5763 (ML5_5763)
Accession : YP_004085371.1
Strain : Micromonospora sp. L5
Genome accession: NC_014815
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6224186 - 6224902 bp
Length : 717 bp
Strand : -
Note : KEGG: saq:Sare_1090 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGGGTAGCGTCTGGCCCATGGGGCGCTACGTGCTCGTCGTCGACGACGACCGGACGGTGAGCGACGTCGTCCGGCGCTA
CCTCGAACAGGACGGCTGCCGGGTCCGGTTGTCCTTCGACGGGCCGGACGCGCTCGCCGCGGCCGAGGAGGAGCCGCCCG
ACCTGGTGGTCCTCGACCTGATGATGCCGGGTCTCGACGGCATCGAGGTGTGCCGGCGGCTGCGGCGCCGGCTGCCCGGC
CTGCCCGTCGTCATGCTCACCGCGCTCGGGGACGAGGCCGACCGGGTCGCCGGGCTGGAGGTCGGCGCGGACGACTACGT
GACCAAGCCGTTCTCGCCCCGTGAACTCGTGCTGCGCATCCGGTCGGTGCTGCGGCGCGCGGCCCCGCAGGACCGGGGAC
CGACAGGGGTGCTGCGCGACGGCGACCTCACCGCGGACACCGACCGGCGCGTCGCCGAGCGCGGCGGGCAGCCGCTGTCG
CTGACCGTACGGGAGTTCGACCTGCTCGCGTTCCTGCTCGCGAACCCGGGACGCGCCTGGTCGCGGGCCGAGCTGCTGGA
CCGCGTGTGGGGCTGGCGGTTCGGCGACCAGTCCACAGTCACCGTCCACGTCCGGCGGCTGCGGGAGAAGATCGAGGACC
GCCCGGCGCAGCCGCGCCGCATCGTCACCGTGTGGGGCGTCGGTTACCGGTACGAGCCGTCGGCGGCGTCCCGGTGA

Protein sequence :
MGSVWPMGRYVLVVDDDRTVSDVVRRYLEQDGCRVRLSFDGPDALAAAEEEPPDLVVLDLMMPGLDGIEVCRRLRRRLPG
LPVVMLTALGDEADRVAGLEVGADDYVTKPFSPRELVLRIRSVLRRAAPQDRGPTGVLRDGDLTADTDRRVAERGGQPLS
LTVREFDLLAFLLANPGRAWSRAELLDRVWGWRFGDQSTVTVHVRRLREKIEDRPAQPRRIVTVWGVGYRYEPSAASR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-30 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-21 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-34 46
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-23 46
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-29 46
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-34 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-35 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-32 45
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 7e-26 44
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-26 44
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 7e-26 44
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0039 Protein 7e-26 44
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-26 44
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-25 43
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-23 43
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 9e-26 43
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 9e-26 42
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-23 42
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-23 41
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 6e-22 41
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 4e-20 41
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 5e-20 41
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator BAC0533 Protein 4e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-31 46
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-30 43
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-24 43
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-23 43
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-22 42
ML5_5763 YP_004085371.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-30 42