Gene Information

Name : Rumal_3501 (Rumal_3501)
Accession : YP_004089832.1
Strain :
Genome accession: NC_014824
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 256378 - 256734 bp
Length : 357 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: cce:Ccel_2969 IS66 Orf2 family protein

DNA sequence :
ATGCTGAATGATCTGGCAGCGGACGCACAGGTCTATCTTGTTACGGGATACACCGACCTTCGACGCGGGATAGACGGACT
TGCGACTATCGTTCAGGCTCAGCTTCGACTTGACCCGTTCTCGAAAGCATTGTTTTTGTTCTGCGGCAGACGTTGTGACC
GCATCAAAGGTCTGCTGTGGGAGGGCGATGGTTTTCTGCTGTTGTACAAGCGCCTTGACAACGGAAGATTCCAGTGGCCG
CGCAGTGAGACCGAAGCAGTAATGCTCACATCTCAGCAAATTCGCTGGCTTCTGGAAGGCTTGAAAATAGAGCAGCCGAA
GGCTATCCGTGAGGGAAAGCCGGGGGCGCTGTATTAA

Protein sequence :
MLNDLAADAQVYLVTGYTDLRRGIDGLATIVQAQLRLDPFSKALFLFCGRRCDRIKGLLWEGDGFLLLYKRLDNGRFQWP
RSETEAVMLTSQQIRWLLEGLKIEQPKAIREGKPGALY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-17 48
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 9e-17 48
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-13 46
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-16 46
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-15 46
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-15 46
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-15 46
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-15 46
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-15 46
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-15 46
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-15 46
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-15 46
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-15 46
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-15 46
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-14 46
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-14 46
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-15 45
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 7e-16 43
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-14 42
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-14 42
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 6e-14 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rumal_3501 YP_004089832.1 IS66 Orf2 family protein VFG1517 Protein 3e-13 46
Rumal_3501 YP_004089832.1 IS66 Orf2 family protein VFG1665 Protein 1e-16 46
Rumal_3501 YP_004089832.1 IS66 Orf2 family protein VFG0792 Protein 8e-16 46
Rumal_3501 YP_004089832.1 IS66 Orf2 family protein VFG1698 Protein 5e-16 46
Rumal_3501 YP_004089832.1 IS66 Orf2 family protein VFG1709 Protein 8e-16 46
Rumal_3501 YP_004089832.1 IS66 Orf2 family protein VFG1052 Protein 2e-15 45