Gene Information

Name : Ethha_1124 (Ethha_1124)
Accession : YP_004091406.1
Strain : Ethanoligenens harbinense YUAN-3
Genome accession: NC_014828
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1235150 - 1235842 bp
Length : 693 bp
Strand : -
Note : KEGG: tte:TTE1016 response regulator; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
TTGAGACAAACAAAAGTGCTGGTCGTTGAGGATGACAAACGTCTCGCACGGCTGCTTGAGTTGGAACTGAAACACGCGGG
CTATGAATCACGTTGCGAGTGCGACGGAACGCAGGGGTTACGCTCCGTTCGTTTCTGGGAACCCGATCTCATCCTGCTCG
ACCGTATGCTGCCGGGGATGGACGGAGTGGAAGTATGCCGGAACGTACGTCTGTTTTCTTCCGTGCCGATCCTGATGCTG
ACGGCCAAGGGAGAGACGGTCGATAAAGTTGAAGGGCTGGACAGCGGCGCCGACGACTACATCACAAAACCATTCCAGAT
GGAAGAGCTTCTGGCGCGCATGCGCGCGGCTCTTCGCGGCAATGATTCGCCTGGGCAAACGCCGCTGCTTGTTGTACAGA
ATCTTACCCTTGATCCGTTCAAGCATACCGTCTGCCGCGATGATACGGAAATCGAGCTTACCAAACGTGAGTTCGATCTG
CTTGAATATATGATGCGCAACCGCAGTATCGTCCTGACGCGCGGGCAGATTCTGGATCATGTCTGGGGCGAGACCTATGA
GGGCGAAGCAAACATTGTGGATGTATACATCCGCTATCTGCGCGGTAAAATGGACGACGCGTTCGAGCCCAAATTGCTTC
ACACAGTTCGAGGAGTGGGATATGTACTGGATAAAAAAAATACCGATTCTTAG

Protein sequence :
MRQTKVLVVEDDKRLARLLELELKHAGYESRCECDGTQGLRSVRFWEPDLILLDRMLPGMDGVEVCRNVRLFSSVPILML
TAKGETVDKVEGLDSGADDYITKPFQMEELLARMRAALRGNDSPGQTPLLVVQNLTLDPFKHTVCRDDTEIELTKREFDL
LEYMMRNRSIVLTRGQILDHVWGETYEGEANIVDVYIRYLRGKMDDAFEPKLLHTVRGVGYVLDKKNTDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-39 52
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 8e-34 50
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-35 48
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 8e-35 46
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-37 46
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-36 46
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family BAC0638 Protein 8e-30 45
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family BAC0308 Protein 7e-32 45
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family BAC0111 Protein 4e-35 45
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family BAC0197 Protein 5e-35 44
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-34 42
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 7e-34 42
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-34 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-29 41
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family VFG1390 Protein 3e-39 45
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family VFG1386 Protein 5e-34 42
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-37 42
Ethha_1124 YP_004091406.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-34 41