Gene Information

Name : Tmar_2344 (Tmar_2344)
Accession : YP_004103148.1
Strain : Thermaerobacter marianensis DSM 12885
Genome accession: NC_014831
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG1576
EC number : -
Position : 2814496 - 2814981 bp
Length : 486 bp
Strand : -
Note : COGs: COG1576 conserved hypothetical protein; InterPro IPR003742; KEGG: bha:BH4007 rRNA large subunit methyltransferase; PFAM: protein of unknown function DUF163; SPTR: ribosomal RNA large subunit methyltransferase H; PFAM: Predicted SPOUT methyltransfera

DNA sequence :
TTGCCCGTCCACATCGAACTGCTGGCCGTGGGCGACCTGGACCAGCCGGCGCTGCGCCGGGCGGCGGAGGAGTACGAACG
CCGCCTCGGCCGCTACGCCCGGGTGAGCCAGCGGCGGGTGCCCGGCGAGCCCGTGCCGGCCCGCCTCTCCCAGGGTGAGG
TGACCCGGGTCCTGGAGGCCGAGGGCCGGCGGTTGCTGGCGGCCCTGTCCCCGGACGCCTACGCCGTGGCCCTGGACCGG
CGCGGCCGCACCCTGACCTCCGAAGACGTGGCGGAGTGGCTCAACCAGCGCATGGTCGCGGGCGACGGCCGGCTGGCCTT
CCTCATCGGCGGACCGCTGGGCCTGGCGCCGGCGGTGCTGGATCGCGCCCGGGAGCGCTGGTCCCTGTCCCACCTGACCT
TTCCCCACCAGATGGTCCCGGTGATCCTCCTGGAACAGCTCTACCGGGCCTTCCGCATCCTGCGGGGCGAACCCTACCAC
TACTGA

Protein sequence :
MPVHIELLAVGDLDQPALRRAAEEYERRLGRYARVSQRRVPGEPVPARLSQGEVTRVLEAEGRRLLAALSPDAYAVALDR
RGRTLTSEDVAEWLNQRMVAGDGRLAFLIGGPLGLAPAVLDRARERWSLSHLTFPHQMVPVILLEQLYRAFRILRGEPYH
Y

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB72121.1 hypothetical protein Not tested Type-IVa SCCmec Protein 4e-22 48
SAR0024 YP_039501.1 rRNA large subunit methyltransferase Not tested Type-II SCCmec Protein 6e-22 48
unnamed BAB72138.1 open reading frame X Not tested Type-IVb SCCmec Protein 4e-22 48
SAV0024 NP_370548.1 rRNA large subunit methyltransferase Not tested Type-II SCCmec Protein 6e-22 48
unnamed BAC67575.1 open reading frame X Not tested Type-IVc SCCmec Protein 4e-22 48
orfXhom BAB83497.1 open reading frame X Not tested SCC 12263 Protein 1e-19 48
unnamed BAA82243.1 orfX Not tested Type-II SCCmec Protein 4e-22 48
unnamed BAD24821.1 conserved hypothetical protein orfX Not tested Type-V SCCmec Protein 4e-22 48
orfX BAA86653.1 open reading frame X Not tested Type-I SCCmec Protein 4e-22 48
SSP0026 YP_300116.1 rRNA large subunit methyltransferase Not tested SCC15305RM Protein 2e-20 48
unnamed BAG06184.1 conserved hypothetical protein orfX Not tested Type-VII SCCmec Protein 4e-22 48
unnamed BAB47681.1 open reading frame X Not tested Type-III SCCmec Protein 4e-22 48
orfX YP_251938.1 rRNA large subunit methyltransferase Not tested SCCmec Protein 2e-21 48
unnamed BAC53844.1 open reading frame X Not tested SRImec-III and SCCmec-III region Protein 4e-22 48
unnamed BAC57492.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-22 48
orfX AAL26648.1 unknown Not tested SCCcap1 Protein 4e-21 47
SE0023 NP_763578.1 rRNA large subunit methyltransferase Not tested SCCpbp4 Protein 9e-22 47
SERP2529 YP_190070.1 rRNA large subunit methyltransferase Not tested Type-II SCCmec Protein 9e-22 47